KEGG   Mycobacterium sp. JLS: Mjls_1277Help
Entry
Mjls_1277         CDS       T00482                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00564  Glycerophospholipid metabolism
mjl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mjls_1277
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mjls_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N AlaDh_PNT_C Pyr_redox Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABN97079
LinkDB All DBs
Position
1363990..1365729
Genome map
AA seq 579 aa AA seqDB search
MSDPIAGNGQTLLGPDQRAEAWRRLGSEQFDVVVIGGGVVGAGAALDAATRGLKVALVEA
RDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPLTN
RWWERPYVAAGIFLYDQLGGAKSVPAQRHLTKSGALRLAPGLKRSSLIGGIRYFDTVVDD
ARHTMMVARTAAHYGAVVRTSTQVVNLLREGDRVIGVAVRDSEDGSVTDVHGHVVVNATG
VWTDEIQALSRQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWIIG
TTDTDWNLDLAHPAATKADIDYILDHVNTVLATPLTHDDIDGVYAGLRPLLAGESEETSK
LSREHAVASPAPGLVAIAGGKYTTYRVMGEDAIDAAAEFVPARVAPSITEKVPLMGADGY
FALINQTQSVGAHYGLHPYRVRHLLDRYGSLISEVLAFADGRPDLLTPITAAPVYLKVEA
AYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPILGWSAEDVSREVDTYC
ARVDAEVRSQQQPDDESADALRAAAPEARAEILEPVPLR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacccgatcgcaggtaacgggcagactttgctcgggcccgaccagcgggccgag
gcctggcggcggctcggcagcgagcagttcgacgtcgtggtgatcggcggtggcgtggtc
ggagccggcgccgccctcgacgccgccacccgtggactcaaggtcgccctggtggaggcg
cgcgacttcgcctccgggacgtccagccgcagcagcaagatgttccacggcggtctgcgc
tacctcgaacagctcgagttcgggctggtccgtgaggcgctgcacgaacgcgagctgtcg
ctgaccacgctggcgccgcacctggtcaaaccgctgcccttcctgttcccgctgaccaac
cgctggtgggagcggccctacgtggcggcgggcatcttcctctacgaccagctcggcggt
gcgaaatccgttcccgcgcagcggcatctgaccaagtccggggcgttgcggctggcgccc
ggactcaaacgcagctcgttgatcggcggcatccgctacttcgacaccgtcgtcgacgac
gcgcggcacaccatgatggtcgcccggacggcggcgcattacggcgcggtggtgcgcacg
tcgacgcaggtggtcaacctgctgcgggaaggtgaccgggtgatcggtgtcgccgtgcgc
gacagcgaggacgggtcggtcaccgacgtccacggccacgtcgtggtcaacgccaccggc
gtgtggaccgacgagatccaggcgctgtcacggcaacgcggccggttccgggtgcgcgca
tccaagggtgtgcacatcgtggtgccccgcgatcggatcgtcagcgaggtcgcgatcatc
ctgcgcaccgagaagtcggtgctgttcgtcatcccgtgggggacgcactggatcatcggc
accaccgacaccgactggaatctcgacctggcgcatccggccgcgacgaaggccgacatc
gactacatcctcgaccacgtcaacaccgtgctggccacgccgctcacccacgacgacatc
gacggcgtctacgccgggctgcgtccgctgctggcgggggagagcgaggagacctcgaaa
ctgtcccgtgagcacgccgtcgccagcccggcgccgggactggtcgcgatcgccggcggc
aagtacaccacctaccgcgtgatgggtgaggatgcgatcgacgcggccgccgagttcgtc
cccgcgcgcgtggcgccgtcgatcaccgagaaggtgccgctgatgggggccgacggatac
ttcgcgctgatcaaccagacccagagtgtcggcgcccattacggtttgcacccgtatcgg
gtgcgtcacctgctcgaccggtacggctcgctgatcagcgaggtgctggcatttgccgac
ggcaggcccgacctgctcaccccgatcaccgcggcgcccgtctacctcaaggtggaggcc
gcgtacgccgcggccgccgagggggcactgcacctcgaggacatcctggcccgccgcatg
cgcatctcgatcgagtatccgcaccgcggcgtcgactgtgcccgtgaggtcgccgaagtc
gttgcgcccattctgggttggagcgccgaggacgtcagccgcgaggtggacacgtactgt
gcgcgcgtcgacgcggaggtgcgcagccagcagcaacccgacgacgagtccgccgatgcg
ctgcgcgcggcggcgcccgaggccagggcggagatcctcgaacccgtcccgttgcgatga

DBGET integrated database retrieval system