KEGG   Mycobacterium sp. JLS: Mjls_1595
Entry
Mjls_1595         CDS       T00482                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00624  Polycyclic aromatic hydrocarbon degradation
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
mjl01220  Degradation of aromatic compounds
Module
mjl_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mjls_1595
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mjls_1595
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABN97393
UniProt: A0A5Q5CDU6
LinkDB
Position
1698574..1700025
AA seq 483 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEIRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKADSYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDVRVVDTLSSAQFHGPGYAQ
LGYNENNQRQLLRLWADYLDMPPLRVNPATVLSDNPHGIEPMVQTNGAAAADIDSGSAES
VML
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttagcggctgtacgcactggcatgatcccggcgcacgtg
tataacgacaagcaaattttctcgctcgagaaggagcgcctgttcagtcgggcgtggttg
ttcgtggcgcacgagtcggagattccgcagccgggggactacgtggtcagacaagtgttg
caggattcgttcatcgtcgctcgtgattctgccggcgagatccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgccgggcggaaatggggaacgcgtcgaacttcaga
tgcccgtaccacgggtggtcttaccgcaatgacggtcgcattattggcctgccgtttcac
caagaggcttacggaggagacgccgggtttaacaagacggggcagaccttgttgcccgcg
ccgagtgtggccagctacaacgggttgatctttctgtcgatggatcctgacgcagaatcg
cttgaagactatctgggtgatttcaggttctatctcgatttctacaccaagcaaggcccc
aacggtcttgaggtgcgaggtccgcagcgttggcgggtaaaagcgaactggaagatcgca
gctgaaaatttcgccggggacatgtaccacacacctcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggctaacaagcgcaaagacggcgccacgtattgggcg
ggtagaggtgggggcaccacatacaagctgcccgaggggagtttcgaggaccggatgagc
tacgtgggctacccggcggacatgattagtcgagccaaggccacctggaccgagcagcag
caacaagtcgtcggcaccgacgggttcatgatctcggccgcgacgtgttttcccaacatc
agtttcgtgcacaactggccgaaagtggaggacggggagcacgtcttgccgttcatttca
atccgggtgtggcagccaatcagcgagaacgaaaccgaggtgctgtcgtggtttgcggtg
gattctgatgccccggcagactttaaggcggactcgtataaggcttatttgatgtgcttc
ggctcgacgggaatgttcgagcaagacgatgtcgagaactgggtgtcgctgaccaacacg
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgtacgggtggtcgacacccttagcagcgctcaattccacgggccgggatacgctcaa
ctcggttacaacgagaacaatcaacggcaattgttgaggctctgggccgactacctggac
atgccgccgcttcgcgtcaacccggctacggtgctcagcgacaatccgcatggaattgaa
ccaatggtccagaccaacggcgcggccgccgccgatattgactcggggtccgctgagtcg
gtgatgctatga

DBGET integrated database retrieval system