KEGG   Mycobacterium sp. JLS: Mjls_1599
Entry
Mjls_1599         CDS       T00482                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, ferredoxin reductase subunit
  KO
K18254  phthalate 3,4-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00624  Polycyclic aromatic hydrocarbon degradation
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
mjl01220  Degradation of aromatic compounds
Module
mjl_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mjls_1599
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Mjls_1599
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C AlaDh_PNT_C Pyr_redox_3 2-Hacid_dh_C NAD_binding_8 DAO XdhC_C NAD_binding_7 K_oxygenase AdoHcyase_NAD TrkA_N GIDA 3HCDH_N
Other DBs
NCBI-ProteinID: ABN97397
UniProt: A0A5Q5CE29
LinkDB
Position
1701784..1703190
AA seq 468 aa
MSGLRELCRCGPGLLRHRRSGTRGGPQDGGSFRGQDPGRGGCAQLSGGRAGSPRRMTSRV
VIVGSSVGGVRTAQALRSQGYDGDVVLVGEETALPYDKPPLSKALLAGTSDIAAVTLLSR
DAAAADRIELLLGRRAIGVDVAACQVEFADDEPLRYDHLVVATGASARPSPWGHGSGIHV
LRTLEDCLRLRDDLVAGVRLVVIGGGFIGAEVASTARSMGGQVTVVDPVPVPMSRVLTEE
IGEWFIDLHRNHGVHTRFGIGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVPNDGWL
MPSGLLVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTNAVDQASCVAH
NILYPDELRCYEPVEYVWSDQYDWKIQVCGQTTHLGEPLVVGDRLSDNRFTVLYPDGEQR
LGGAAVVNWPRALIECRRALQAGSDLESVRGRLEVLTNPPDTAATRSP
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtcagggctacgcgaactgtgtcgttgcggccccggattacttcgacatcgacgatcg
gggactcgtggaggtccgcaagacggaggttccttccgcggacaggacccgggtcgagga
ggctgcgcgcagctgtccggtggccgcgctggaagtcctagacgaatgacgtcgcgggtc
gtcatcgtcggcagttctgtcggcggggtccgcacggcccaggcgctgcgctcgcaaggc
tacgatggcgacgtcgtcctggtgggcgaggaaactgcgctgccctacgacaagccgcca
ttatccaaggcattgcttgcgggtacgagtgacatcgccgctgtgacgttactcagtaga
gacgctgccgccgccgaccgcatcgagcttctcctcggccgccgcgcgatcggagtggat
gtcgcagcgtgtcaggtcgagttcgccgatgatgagcccctgcgttatgaccacctggtg
gtggccaccggagccagcgcgcgaccatccccgtggggccacggatcgggcattcatgtg
ctccgcactctggaggactgtctgcggctacgggacgaccttgtcgccggtgtccgcctc
gtggtgatcgggggaggattcatcggggccgaagttgcgtcaaccgcccggtcaatgggg
gggcaggtgaccgttgtcgacccggtgcccgttccgatgagcagggttctgaccgaagag
atcggcgagtggttcatcgatttgcaccgaaaccacggagtgcacacgcgcttcggtatc
ggtgtcgagaatattgagggggagcgcggcaaccttaagatcggcctcacggacgggacg
gtcctagaagccgacacggtggtggtgggcatcggcgccgttccgaatgacggctggctg
atgccgtcgggactgctagtcgatgacggcctggtctgcgacgagttctgtcgtgcagtt
acgtcacaaaacatctacgcagtcggcgacgtgtcgcgttggttccatcgcgcccgcggc
gtgacgatgcgcatcgaacactggacaaacgcggtcgaccaggcctcttgcgtcgcgcat
aatattttgtatcccgatgaattgcgctgctacgagcccgtcgagtacgtctggagcgac
cagtacgactggaagattcaggtctgtggccagacaactcacctaggagagccactcgtc
gtcggagatcgactgtccgacaatcgattcacagtcctctacccggatggcgagcaacgt
cttggtggcgcggcggtggtgaactggcctcgagcactgatcgagtgcaggcgtgcgctg
caggccggtagcgatctcgaaagtgtgcggggaaggctcgaagtgttgacgaacccaccc
gataccgccgcaacgcgatcgccatag

DBGET integrated database retrieval system