KEGG   Mycobacterium sp. JLS: Mjls_3731Help
Entry
Mjls_3731         CDS       T00482                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mjl  Mycobacterium sp. JLS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN99507
LinkDB All DBs
Position
3951158..3952639
Genome map
AA seq 493 aa AA seqDB search
MRGDELFIGGTWCAPSTDRRIEVISPHTETTVGHVAAAAPADVDRAVGAAREAFDTGGWP
RTSPAGRIDAVRRLAANYERRRSEMAELITSEIGAPISFSQRAQVALPWSMINAFCDLAQ
TYPWREARPGRYGSDVQVLREPVGVVGAVVPWNMPQFLIVTKLIPALLAGCTVVVKPAPE
SPLNALLLAEVIAESGLPPGVVSVLPGDGSVGEYLVGHRGVDKVSFTGSTAAGRAVATAC
AADLRRVSLELGGKSAAIVLDDADPVVVAAGVRSASLSNSGQICNALTRVLVPRSRAGEF
TDALAAEVSALVVGDPTDGATQVGPLVARRQQQRVTGYLEQGVRDGARVVTGGTGMPDGL
DRGWYVKPTVFDRADNSMTIAREEIFGPVLTVIAYDNEDEAVAIANDSDYGLAGSVFTAD
TDRGLAVGAAIRTGTFGVNQGYTMDPFAPFGGVKSSGYGRELGREGIDGYVDTKSISVAP
KQDPATAAAGKGA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtggcgacgagttgttcatcggcggcacctggtgtgcaccgagcaccgaccggcgg
atcgaggtcatctccccgcacaccgagacgaccgtcggccacgtcgccgccgccgcaccc
gccgacgtcgaccgggccgtgggcgccgcccgggaagcgttcgacaccggcgggtggccg
cggacgtcgccggcaggccggatcgatgcggtgcgccggctcgccgcgaactacgaacgg
cgccgctccgagatggccgagctcatcacctccgagatcggcgcgccgatcagcttctcg
cagcgggcccaggtggcactgccgtggtcgatgatcaacgccttctgcgatctggcgcag
acgtatccgtggcgagaggcccgccccggtaggtacggctccgacgtccaggtgctgcgt
gagccggtcggcgtcgtcggcgcggtcgtgccgtggaacatgcctcagttcctcatcgtc
accaagctgatcccggcgttgctggcggggtgcaccgtcgtcgtcaagcccgctcccgag
tcaccgttgaacgctctactgctcgccgaggtgatcgccgagtccggtttgccgccgggc
gtggtcagcgtgctgcccggcgacgggagcgtcggcgagtacctggtgggccatcgcggc
gtggacaaggtgtcgttcaccgggtcgacggccgcaggccgggccgtcgccaccgcatgc
gcggccgacctgcggcgggtcagcctcgaactggggggcaagtcggcggccatcgtcctc
gacgacgccgatcccgttgtggtcgccgcgggcgtgcggtcggcgagcctgtccaacagc
ggtcagatctgcaatgcgctcacccgcgttctcgtccccaggtcccgcgccggggagttc
accgatgcgttggccgcggaggtcagcgcgctggtcgtcggcgaccccaccgacggtgcc
acccaggtcggcccgctcgtggccagacggcaacagcagcgggtcaccggctacctcgag
cagggtgtgcgggacggcgcgcgggtggtcactggtggcacgggcatgcccgacggactc
gaccgcgggtggtacgtcaagcccaccgtcttcgaccgggcggacaactcgatgacgatt
gcgcgcgaggagatcttcgggcccgtgctgacggtcatcgcctacgacaacgaggacgag
gcggttgccatcgccaacgactccgactacggcctggctggatcggtgttcactgcggac
accgacagagggctggccgtcggcgcggcgatccgcaccggcaccttcggcgtcaaccag
ggctacacgatggatccgttcgccccgttcggtggcgtgaagtccagcggctacgggcgt
gagctcggtcgggagggcatcgacgggtacgtcgacaccaagtcgatctccgttgcgccg
aaacaggatcccgccacggcggccgcgggcaagggagcgtga

DBGET integrated database retrieval system