KEGG   Mycobacterium sp. JLS: Mjls_5284Help
Entry
Mjls_5284         CDS       T00482                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mjl  Mycobacterium sp. JLS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABO01048
LinkDB All DBs
Position
complement(5534860..5535795)
Genome map
AA seq 311 aa AA seqDB search
MFRDGDDVVLMSRSGKDLARYFPEVLDFVRDELAPRCVLDGEIVVPREIGGRTRLDWESL
SQRIHPAESRVRKLSEETPAHFIGFDALASGDTSLMKEPFRARRQALIEAVSHKQWCHVT
RTTEDPGLGAQWLEEFEGAGLDGVIAKRLDGSYLPGKREMVKVKHARDADCVAIGYRIHK
SGEGIGSLLLGLYTDEGDLQMVGGAASFTAKDRLKLLAELEPLREGDEVREGDPSRWNSA
ADKRWIPIRPERVAEVAYDQMEGNSVQGRRFRHAVKFRRWRPDRDPASCTFDQLEVPLTY
DLFDVLETQDG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgcgacggtgacgacgtcgtgctgatgtccaggagcggcaaggacctggcgcgg
tacttccccgaggtgctcgacttcgtgcgcgacgaactggccccgcgctgtgtgctcgac
ggcgagatcgtcgtcccccgtgagatcggcggtcgcacccggctggactgggagtcgctg
agccagcgcatccatcccgccgaatcgcgcgtgcgcaagctctccgaggagacccccgcg
catttcatcggtttcgacgcactcgccagcggtgacacctcgctgatgaaggagccgttc
cgcgcccggcgtcaggcgctcatcgaggctgtctcgcacaagcagtggtgtcatgtcacg
cggaccacggaggaccccgggctcggtgcgcagtggctcgaggagttcgagggtgccggt
ctcgacggtgtgatcgccaaacgcctcgacggctcgtacctgccgggtaagcgggagatg
gtcaaggtcaaacacgcccgcgacgccgactgcgtggccatcggctaccggatccacaag
agcggggaggggatcggctcgctgctgctcggactgtacaccgacgagggcgacctccag
atggtcggcggggcagcgtctttcactgccaaggaccggctcaagctgctcgccgaactc
gaaccgctgcgtgagggggacgaggtgcgggagggcgatccgagccgttggaactccgcg
gcggacaagcgctggataccgatccggccggagcgggtcgcggaggtggcctatgaccag
atggagggaaactcggtgcaggggcggagattccgacatgcggtcaagttccggcgatgg
cggccggaccgcgatccggccagttgcacgttcgaccaactggaagttccgctgacctac
gacctcttcgacgtgttggagacccaggatggctag

DBGET integrated database retrieval system