KEGG   Mesorhizobium jarvisii: EB229_18730
Entry
EB229_18730       CDS       T06715                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mjr  Mesorhizobium jarvisii
Pathway
mjr00473  D-Alanine metabolism
mjr00550  Peptidoglycan biosynthesis
mjr01100  Metabolic pathways
mjr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mjr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EB229_18730
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EB229_18730
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EB229_18730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mjr01011]
    EB229_18730
Enzymes [BR:mjr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EB229_18730
Peptidoglycan biosynthesis and degradation proteins [BR:mjr01011]
 Precursor biosynthesis
  Amino acid ligase
   EB229_18730
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A ATPgrasp_ST
Other DBs
NCBI-ProteinID: QKC64098
LinkDB
Position
3759356..3760282
AA seq 308 aa
MKSKHVAVLLGGFSSERPVSLSSGKACADALENEGYQVTRVDVGRDVGSVLAELKPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMNKEQAKKIVKSVGVPVAESKVANR
FAIQNKHPMKPPYVIKPVNEGSSFGVVIVSEGQSHPPQVVGSSEWKYGDTVMVERYIHGR
ELTCAVMGDVALGVCEIIPTGHSFYDYDSKYVAGGSKHECPAKVSPNIYQKIQTLALKAH
QAVGCRGVSRSDFRYDDRHSENGEVVWLEVNTQPGMTPTSLVPEIAAHAGHSFGELLSWM
VEDASCQR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaaaagcaagcatgtggccgtcctgctgggaggtttttcgtccgagcggcccgtgtcc
ctgtcctccggaaaggcctgtgccgatgcgctggagaatgagggttatcaggtcacccgc
gtcgatgtcggacgcgatgtcggctcggtgcttgcggaactcaagcctgatgttgccttc
aatgcgctgcacggcccgttcggcgaggacggcaccatccagggcatcctcgaatatctc
gccatcccctacacccattccggcgtgctcgcctcggcgctcgccatgaacaaggagcaa
gcgaagaagatcgtcaaatcggtcggcgttcccgtcgccgaatcgaaggtcgccaatcgc
ttcgccatccagaacaagcatccgatgaagccgccctatgtgatcaagccggtcaatgaa
ggatcgagctttggcgtcgtcatcgtgtcggaggggcagtcgcatccgccgcaggtcgtc
ggctcgtccgaatggaaatatggcgataccgtcatggtcgagcgctacatccacgggcgc
gagctgacctgcgccgtcatgggtgatgtggcgcttggcgtctgcgagatcatcccgacc
ggccattccttctatgattacgattcaaaatatgtcgcgggcggatcaaaacacgaatgc
cccgcaaaagtttcaccgaatatttaccaaaaaatacagacactggcgctcaaggctcac
caagctgtcggctgtcggggcgtttcccggtcggacttccgttatgacgatcgtcactcc
gaaaatggcgaagttgtatggctcgaggtcaacactcagccgggcatgacgccgacgtct
ctggtgcctgaaatcgcggcccatgccgggcattcgtttggtgagttgttgagttggatg
gtggaggacgcttcgtgtcagcgttga

DBGET integrated database retrieval system