KEGG   Manis javanica (Malayan pangolin): 108383250
Entry
108383250         CDS       T06054                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04144  Endocytosis
mjv04150  mTOR signaling pathway
mjv04270  Vascular smooth muscle contraction
mjv04310  Wnt signaling pathway
mjv04350  TGF-beta signaling pathway
mjv04360  Axon guidance
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04530  Tight junction
mjv04611  Platelet activation
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04670  Leukocyte transendothelial migration
mjv04722  Neurotrophin signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv04921  Oxytocin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04972  Pancreatic secretion
mjv05100  Bacterial invasion of epithelial cells
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108383250 (RHOA)
   04015 Rap1 signaling pathway
    108383250 (RHOA)
   04310 Wnt signaling pathway
    108383250 (RHOA)
   04350 TGF-beta signaling pathway
    108383250 (RHOA)
   04072 Phospholipase D signaling pathway
    108383250 (RHOA)
   04071 Sphingolipid signaling pathway
    108383250 (RHOA)
   04024 cAMP signaling pathway
    108383250 (RHOA)
   04022 cGMP-PKG signaling pathway
    108383250 (RHOA)
   04150 mTOR signaling pathway
    108383250 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108383250 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108383250 (RHOA)
   04520 Adherens junction
    108383250 (RHOA)
   04530 Tight junction
    108383250 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108383250 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108383250 (RHOA)
   04621 NOD-like receptor signaling pathway
    108383250 (RHOA)
   04625 C-type lectin receptor signaling pathway
    108383250 (RHOA)
   04660 T cell receptor signaling pathway
    108383250 (RHOA)
   04670 Leukocyte transendothelial migration
    108383250 (RHOA)
   04062 Chemokine signaling pathway
    108383250 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108383250 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    108383250 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108383250 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    108383250 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108383250 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    108383250 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108383250 (RHOA)
   05206 MicroRNAs in cancer
    108383250 (RHOA)
   05205 Proteoglycans in cancer
    108383250 (RHOA)
   05203 Viral carcinogenesis
    108383250 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108383250 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108383250 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108383250 (RHOA)
   05135 Yersinia infection
    108383250 (RHOA)
   05133 Pertussis
    108383250 (RHOA)
   05152 Tuberculosis
    108383250 (RHOA)
   05100 Bacterial invasion of epithelial cells
    108383250 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108383250 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108383250 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108383250 (RHOA)
   04031 GTP-binding proteins [BR:mjv04031]
    108383250 (RHOA)
Membrane trafficking [BR:mjv04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    108383250 (RHOA)
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108383250 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   108383250 (RHOA)
  Exosomal proteins of colorectal cancer cells
   108383250 (RHOA)
  Exosomal proteins of bladder cancer cells
   108383250 (RHOA)
GTP-binding proteins [BR:mjv04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    108383250 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 108383250
NCBI-ProteinID: XP_017495121
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc
ttgctcatcgttttcagcaaggaccagttcccagaggtgtatgtgcccaccgtgtttgag
aactatgtggcagacatcgaggtggatgggaagcaggtggagctggctttgtgggacaca
gctgggcaggaggattacgatcgcttgcggcccctctcctacccggacaccgacgtcata
ctgatgtgtttctccatcgacagccctgatagcttagaaaacatcccagaaaaatggact
ccggaagtcaagcatttctgccccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacaccaggcgggaactggccaagatgaaacaggagccagtaaaa
ccggaagaaggcagagacatggctaacaggatcggcgcctttgggtacatggagtgctcc
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaagaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system