KEGG   Manis javanica (Malayan pangolin): 108383562
Entry
108383562         CDS       T06054                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108383562 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108383562 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108383562 (IL12RB1)
   04659 Th17 cell differentiation
    108383562 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108383562 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108383562 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108383562 (IL12RB1)
   04090 CD molecules [BR:mjv04090]
    108383562 (IL12RB1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108383562 (IL12RB1)
CD molecules [BR:mjv04090]
 Proteins
  108383562 (IL12RB1)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 108383562
NCBI-ProteinID: XP_017495631
LinkDB
Position
Unknown
AA seq 549 aa
MGQPVATLAPFLLLLLPAQGAEACSTSRCCFQDLPYPDADSGSTSGPRDLTCYRVFSAGY
ECSWQYEGPAAGVSHFLRCCLRPGRCCYFAAGSATKLQFSDQDGVSVLYAVTLWVESRAA
NRTEKSPEVTLKLYSLVKYDPPPEDIKVSRSAGQLRMEWETPARQDGAEVQFRHRTPGSP
WKLGDCGHQADAGFESCLCPLEMDAAQEFQLRRRQLSAAALGGPWSGWSSSVCIPPETTP
QPEVNFSVEPLGLDGRRRVALHWQLPQLEAPEGCLRPSSGMEVTYYIHLHMLSCPCKGKA
TRMRHLRKVLMLSGAAYNLTVVSWNRFGPGSNQTWHIPAHTSTVTRCLPEFPACQVPHWP
YPDGSPAAHPVALGGQVCYKDTIFRDEIPEAQKEPGALSVRTGVAGTTMQWPARAQGLTY
CIEWQPRGWDGSLAACTLITPRDRNPAGMASHTWSQAAGAMGQKTCYHVMIFASAHPEKP
TSWSTVLSAYHFGGNASGAGSPQHVSVRKLSRDSVSVAWTPSPLSLCPGTLKEYVVRCRN
EDSNQVSGK
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggggcagccggtggccacactagcccccttcctcttacttctgctccctgcgcagggt
gctgaagcctgcagtaccagcaggtgctgttttcaggacctgccctatccggatgcagac
tcaggctccacttcaggccccagggacctgacctgctaccgggtgttcagcgctggttac
gaatgctcctggcagtatgagggtcctgcagccggggtcagccacttcctgaggtgctgc
ctcaggcctgggcgctgctgctacttcgccgcaggatcagccaccaagctgcagttctcc
gaccaggacggtgtatccgtgctctatgctgtcacgctctgggtggaatcccgggccgcg
aaccggacagagaagtcgcctgaggtcaccctgaagctttatagcttggttaaatatgac
cctccgccagaagacatcaaggtatccaggtcagcagggcagctgcgcatggagtgggag
accccagcccgccaggatggggctgaagtgcagttccggcaccggacacctggcagccct
tggaagttgggtgactgcggacatcaggctgatgctggcttcgagtcatgcctctgtccc
ctggagatggatgcagcccaggaatttcagctacggaggcggcagctctcggcggcagct
ctgggaggtccctggagtggctggagcagctctgtgtgcatcccccctgaaactacccca
cagcctgaggtgaatttctcggtggagccccttggcctggatgggagaaggcgggtggcc
ctgcactggcagctgccccagttggaggctccggaaggctgcctcaggcccagctctggc
atggaggtgacctactacatccacctgcacatgctgtcctgtccgtgcaagggcaaggcc
acgaggatgcggcatctgaggaaagtgcttatgctctcgggcgccgcctacaacctgact
gtggtctcctggaatcgcttcggccccggctcaaaccagacgtggcacattcctgcccac
accagcacagttactcggtgcctccctgaatttcctgcctgccaagtgcctcactggcct
taccctgacggtagccctgctgcgcacccagtggccctgggagggcaggtctgctacaag
gacacaattttcagagatgagatacctgaggctcagaaagaaccaggagctctgagcgtc
aggactggagtggctgggaccactatgcagtggccagcccgagcccagggcctgacatac
tgcattgaatggcaacctcggggctgggacggaagcctcgctgcctgcaccctgatcaca
ccccgggaccggaaccctgctggcatggcatcccatacctggagccaagcagctggggca
atggggcagaagacgtgttatcacgtcatgatcttcgcctctgcacatccggagaagccc
acctcatggtccacagtcttgtctgcctaccactttgggggcaatgcctcaggggccgga
agcccacagcacgtgtcggtgaggaaactcagccgggactcagtgtccgtggcctggacg
ccgtccccactgagcctctgccctggcaccctgaaggagtacgtcgtgcgctgccggaat
gaggacagcaaccaggtgtcaggtaagtga

KEGG   Manis javanica (Malayan pangolin): 108384839
Entry
108384839         CDS       T06054                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108384839 (IL2RA)
   04151 PI3K-Akt signaling pathway
    108384839 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108384839 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108384839 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108384839 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108384839 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    108384839 (IL2RA)
   04659 Th17 cell differentiation
    108384839 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108384839 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108384839 (IL2RA)
   05162 Measles
    108384839 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108384839 (IL2RA)
   04090 CD molecules [BR:mjv04090]
    108384839 (IL2RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108384839 (IL2RA)
CD molecules [BR:mjv04090]
 Proteins
  108384839 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 108384839
NCBI-ProteinID: XP_017497530
LinkDB
Position
Unknown
AA seq 154 aa
FPFPLPGHCGEPPPWEHEALERIYHFRVGQKVHYQCAQGFRAQQRGPAESICKLHCGETR
WTWPQLKCINERGSQFPGEDKPQASTDAPPGSDTSCPLKTTGPTGATDFQKYTEVATTIE
TFIFAAKYQIAVAGCILLLISVLLLSGLTWQRRR
NT seq 467 nt   +upstreamnt  +downstreamnt
aatttcctttccctcttccaggccactgcggggagcctccaccgtgggaacatgaagctt
tggaaagaatttatcatttcagggtagggcagaaagttcactaccagtgcgcccagggat
tcagggcccagcagagaggtcctgctgagagcatctgcaaactgcactgtggggagacga
ggtggacgtggccacagctcaagtgcataaatgaaagggggagtcagttcccaggtgagg
acaagcctcaagcaagtactgatgctcctcctgggagtgacacttcctgtcccttaaaaa
ctacaggccccacaggcgccacagattttcaaaaatatacagaagtggctactaccatag
agacgttcatatttgcagccaagtaccagatagcagtggctggctgcatcctcctgctga
tcagtgtcctccttctaagtggactcacctggcagaggagacggtga

KEGG   Manis javanica (Malayan pangolin): 108385397
Entry
108385397         CDS       T06054                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05165  Human papillomavirus infection
mjv05200  Pathways in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385397 (PDGFRB)
   04014 Ras signaling pathway
    108385397 (PDGFRB)
   04015 Rap1 signaling pathway
    108385397 (PDGFRB)
   04630 JAK-STAT signaling pathway
    108385397 (PDGFRB)
   04020 Calcium signaling pathway
    108385397 (PDGFRB)
   04072 Phospholipase D signaling pathway
    108385397 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    108385397 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385397 (PDGFRB)
   04540 Gap junction
    108385397 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108385397 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385397 (PDGFRB)
   05206 MicroRNAs in cancer
    108385397 (PDGFRB)
   05230 Central carbon metabolism in cancer
    108385397 (PDGFRB)
   05231 Choline metabolism in cancer
    108385397 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    108385397 (PDGFRB)
   05218 Melanoma
    108385397 (PDGFRB)
   05215 Prostate cancer
    108385397 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108385397 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385397 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108385397 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mjv04090]
    108385397 (PDGFRB)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108385397 (PDGFRB)
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108385397 (PDGFRB)
CD molecules [BR:mjv04090]
 Proteins
  108385397 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 108385397
NCBI-ProteinID: XP_017498304
LinkDB
Position
Unknown
AA seq 965 aa
MGSSLSLGQGGVLFKGCACLVSLRLSHEEGCQGACALISDASSPKGHVLFLPLLLLLGAQ
ASRDLVITPPGPELVLNVSSNFILTCSGPAPVVWERLSREPLQELTKTQDGTFSSMLTLT
NVTGIDTGEYFCTYKGSQGLESGEQKRLYIFVPDPTVGFLPVDPEELFIFLTEIAETTIP
CRVTDPRLVVTLHEKKVDVPLPIPYDHQHGFSGIFEDKTYVCKTTIGDKEVDSEAYYVYS
LQVSSINVSVNAVQTVVRQGENITIICIVTGNEVVNFEWIYPRLESGRLVEPVTDFLFSV
PSHIRSILHIPSAELGDSGTYICNVSESVNDHRDEKAVNVTVVESGYVQLLGELDTVQFA
ELHRSRTLQVVFESYPPPTVMWFKENRTLGDSSAGEIALSTRNLSETRYVSELTLVRVKV
AEAGHYTMRAFHEDAEAQVSFQLQVNVPVRVLELSESHPASGEQTVRCRGRGMPQPHLTW
STCSNLKRCPRELPPMPLGNSSEEESQLETNVTYWAEEQEFEVVSTLRLHRVDQPLSVRC
TLQNLLGHDIQEVTVVPQSLPFKVVVISAILALVVLMIISLIILIMLWQKKPRYEIRWKV
IESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQAT
MKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGD
LGDYLHRNKHTFLQRCPDKCCPPSTELYSNALPAGLTLPSHVSLPGESDGGYMDMSKDES
VDYVPMLDMKGDIKYADIDPSNSMAPYDNYVPSAPERTCRATLIDESPVLSYMDLVGFSY
QVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLK
WMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAH
ASDEM
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgggttccagtctgagtttgggtcagggaggtgtgctctttaaaggctgtgcctgtctg
gtctcgcttaggctcagccacgaggaggggtgccaaggtgcctgtgccctgatctctgat
gcctcttctcccaaaggccatgtgctgtttctacccctgctgttgctgctgggagcacag
gcctccagggacctggtgatcacacccccagggccagagctggtcctcaatgtctccagc
aacttcattctgacctgctcgggtccagctccagtggtgtgggaacggctgtcccgggag
cccctgcaggaactcaccaagacccaggatggcaccttctccagcatgctaacgctgacc
aatgtcactgggatagacacaggagaatacttttgtacctacaaaggctcccaggggctg
gagtctggtgagcagaaacgactctacatctttgtgccggatcccactgtgggcttcctc
cctgttgaccctgaggaactattcatctttctcacggaaatagctgagaccacaattcca
tgccgagtgacagatccacgactggtggtgacactgcacgagaagaaagtggatgtccca
ctccccatcccctatgaccaccaacatggcttctctggtatctttgaggacaagacctat
gtctgcaaaaccaccattggggacaaagaggtggattctgaagcctactatgtctacagc
ctccaggtgtcatccatcaatgtctcagtgaatgcagtgcagactgtggtccgccagggt
gagaacatcaccatcatatgcattgtgactgggaacgaggtggtcaactttgagtggata
tacccacgcctggagagtgggcggctggtggagccagtgactgacttcctcttcagtgta
ccctcccacatacgctccatcttgcacatccccagcgctgagctgggcgactctgggacc
tacatctgcaatgtatcagagagtgtgaatgaccatcgagatgaaaaggccgtcaatgtc
actgtggttgagagcggctacgtacagctgctgggagaactagacactgtacagttcgcg
gagctgcaccgcagccggacactgcaggtggtgttcgagtcctacccgccgcccactgtc
atgtggttcaaggaaaaccgcacactgggcgactctagcgccggggagatcgccctgtcc
acacgcaatctgtctgagacccggtatgtgtcagaactgacactggtgcgggtgaaggtg
gctgaggctggccactataccatgcgggccttccatgaggacgctgaggcccaggtctcc
ttccagctgcaggtcaacgtgcctgtccgtgttctggagctgagtgagagccaccctgcc
agtggggagcagacagtccgctgccgaggccggggcatgccccagccacacctcacctgg
tctacctgcagcaacctcaaaaggtgtccacgcgaactgccacccatgccattgggtaac
agttctgaggaggagagccagctggagactaatgtgacttattgggctgaggagcaggag
tttgaggtggtgagcacactgcgcctgcaccgtgtggatcagccactgtcggtgcgctgc
acgctgcaaaacctgctgggccacgacattcaggaggtcaccgtggtgccacaatctctg
ccctttaaggtggtggtgatctcagccatcctggccttggtggtgctcatgatcatctcc
ctcatcatcctcatcatgctttggcagaagaagccacgttatgaaatccgatggaaggtg
attgagtctgtcagctctgatggccatgagtatatctacgtggaccctatgcagctgccc
tacgactccacctgggagctgccacgggaccagcttgtgctcggacgcaccctgggctcc
ggggcctttgggcaggtggtggaggccacggctcacggcctgagtcattcacaggccacg
atgaaagtggctgtcaagatgctgaaatccacggcccgcagcagtgagaagcaagccctc
atgtcagagctaaagattatgagtcacctcggaccccacctgaatgtggtcaacctgctg
ggggcctgcaccaaaggagggcccatctacatcatcactgaatactgccgctatggtgac
ctgggggactacctgcaccgcaataagcacaccttcctgcagcgctgccctgacaagtgc
tgcccgcccagcaccgagctgtacagcaacgccctgccagccggcctcaccctgcccagc
cacgtgtccctgcctggggagagtgacggtggctacatggacatgagtaaggatgagtcg
gtggactacgttcccatgttggacatgaaaggagacatcaaatatgcagacattgacccc
tccaactccatggccccttatgataactatgttccctcagctcccgagaggacctgccgg
gcgactctgatcgacgagtccccagtgcttagctacatggatcttgtgggcttcagctac
caggtggccaacggcatggagttcctagcctccaagaactgtgtgcaccgggacctggca
gccaggaatgtgctcatctgtgagggcaagcttgtcaagatctgtgactttggtctggcc
cgtgacatcatgcgtgactcgaactacatctccaaaggcagtaccttcctgcctctgaag
tggatggcccccgagagcatcttcaacagcctctacaccaccctgagcgacgtgtggtcc
ttcgggatcctgctctgggagatcttcaccctgggtggcaccccttatccagagctgccc
atgaatgagcaattctacaatgctatcaagcggggctaccgcatggcccagcctgcccat
gcttccgatgagatgtga

KEGG   Manis javanica (Malayan pangolin): 108385741
Entry
108385741         CDS       T06054                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05163  Human cytomegalovirus infection
mjv05200  Pathways in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385741 (PDGFRA)
   04014 Ras signaling pathway
    108385741 (PDGFRA)
   04015 Rap1 signaling pathway
    108385741 (PDGFRA)
   04630 JAK-STAT signaling pathway
    108385741 (PDGFRA)
   04020 Calcium signaling pathway
    108385741 (PDGFRA)
   04072 Phospholipase D signaling pathway
    108385741 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    108385741 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108385741 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385741 (PDGFRA)
   04540 Gap junction
    108385741 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108385741 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385741 (PDGFRA)
   05206 MicroRNAs in cancer
    108385741 (PDGFRA)
   05230 Central carbon metabolism in cancer
    108385741 (PDGFRA)
   05231 Choline metabolism in cancer
    108385741 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    108385741 (PDGFRA)
   05218 Melanoma
    108385741 (PDGFRA)
   05215 Prostate cancer
    108385741 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108385741 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385741 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108385741 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mjv04090]
    108385741 (PDGFRA)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108385741 (PDGFRA)
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108385741 (PDGFRA)
CD molecules [BR:mjv04090]
 Proteins
  108385741 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 108385741
NCBI-ProteinID: XP_017498773
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHRALLVSGCLLTGLSLILCQLSLPSILPNENEKVVRLNSSFSLSCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLAVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVTASYDSRQGFNG
TFGVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGDTIVVTCAVFNN
EVVDLQWTYPGEVKGKGRTTLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSQLEAVDLHEVKHFVVDVEAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWMILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEIKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKEWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatcgggccctcctggtctcaggctgtctgctcacagggctgagccta
atcctctgccagctttcattgccctctatccttccaaatgaaaatgaaaaggttgtgcgg
ctgaattcatccttttctctgagctgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaatgaggagaacaacagtggcctt
tttgtgacagtgctggcagtggtcaatgcctccgcagcccacacgggattgtacacttgc
tattacaaccacactcagacagaggaaaatgagattgaaggcagacgaatctacatctat
gtaccagacccagatgtagcctttgtacctctaggaatgacagattatttagtcattgtg
gaggatgatgattctgccatcataccttgtcgcacaactgatcctgagaccccggtgacc
ttactcagcagtgacggggtagtgacggcctcctatgacagcagacagggctttaacgga
accttcggtgttgggccctatatctgtgaggctactgtcagagggaagaagttccagacc
atcccatttaatgtgtatgctttaaaagcaacatcagaacttgatctagaaatggaagct
cttaaaactgtatataagtcgggggacacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggccggacaacg
ctcgaggaaatcaaggtcccatccatcaaactggtgtacactctgacagtccctgaggcc
accgtgaaagacagtggagattacgaatgtgctgcacgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtccatgagaaagggttcattgaaatcaaacccaac
tttagccagttggaagctgtggacctgcatgaagtcaaacattttgtggtggacgtggag
gcctatccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
actgagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagttcaaaacgaagat
gacgtgaagagctatactttcgaactgttaactcaggttccctcatctattctggactta
gtggatgaccaccatggttctaccgggggacagaccgtgagatgcacagctgaagggaca
cctcttcctgatattgagtggatgatttgcaaggatatcaagaaatgtaataatgaaacc
tcgtggatgattttggccaacaacatctcaaacatcatcacagaggtccacccgcgagac
aggagtacggtggagggcagagtgactttcgccaaagtggaggagaccattgcggttcga
tgtctggcaaagaatctccttggggctgagaatcgagagctgaagctggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgctgttggtgattgtcatcatc
tcacttattgttctggttgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcaatcagccctgatggacacgaatatatttatgtggatccgatgcagctg
ccttatgactcaagatgggagtttccgagagatggactagtgcttggtcgtatcctggga
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccagcct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccgcatttaaatattgtaaacttg
ctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgaaccctgctgatgagagcacacggagttac
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtcccaatgctggaaaggaaagaggtttctaaatattcggacatccagagatca
ctatatgatcgcccagcctcgtataagaagaaatccatgttagactcagagatcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttaagctttacttac
caagttgcccgaggcatggagttcttggcttcaaaaaattgtgtccaccgggacctggct
gctcgcaatgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcacgactcgaactacgtgtcaaaaggcagtacttttctcccagtgaag
tggatggctccggagagcatctttgacaacctgtacactacactgagtgacgtctggtct
tacggcattctcctctgggagatcttttccctcggtggcaccccctaccccggcatgatg
gtggattctaccttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatcttctgcctggacaatacaaaaag
agctatgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcacgcatg
cgcgtggactcggacaacgcctacattggcgtcacctacaagaacgaggaagacaagctg
aaggagtgggagggcagcctggacgagcagaggctgagcgcggacagcggctacatcatc
cctctgcccgacatagaccctgtaccggaggaagaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctacattcatc
aagagagaggatgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtaa

KEGG   Manis javanica (Malayan pangolin): 108385993
Entry
108385993         CDS       T06054                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04066  HIF-1 signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385993 (IFNGR2)
   04066 HIF-1 signaling pathway
    108385993 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108385993 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108385993 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108385993 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    108385993 (IFNGR2)
   04659 Th17 cell differentiation
    108385993 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108385993 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385993 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108385993 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108385993 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108385993 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    108385993 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    108385993 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108385993 (IFNGR2)
   05140 Leishmaniasis
    108385993 (IFNGR2)
   05142 Chagas disease
    108385993 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108385993 (IFNGR2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IFN receptor family
   108385993 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 DUF2207
Other DBs
NCBI-GeneID: 108385993
NCBI-ProteinID: XP_017499110
LinkDB
Position
Unknown
AA seq 486 aa
MELRYRQPPSFGRSVIVGVKSCETQPRRMDIDIFGGHYSAYSRVILLSTVPSTGLGALLV
VTRGWGWVTALTRRSPPGVLHSLPEAGLPFSAQSGDVLDHGSPNKPDGLPQRAACCRAGP
VCLPLALASMRPESTFLLLTLPFAPTSPSFSYSLCPFQDPLSQLPAPQNPKIHLYNAEQV
LSWEPVSLSNDTRLVVYQVQFKYSISSRWYDVSVDDIGVNCMNLTTTTCNFTPTSLSKGF
PPHFNVSLRVRAKLRDLVSAWLTVPWFQYCRNVTVGPPGNIWVTPREGSLIVRLSSPFSI
EASMATFLYYVHYWEKTGRQQVKGPYRSNSIVLNDLKPLRVYCLQVKAQLFWTIENISRP
GHLSNISCYETTADASTKLQQVILIAVVTFLLLLALAGACLSLVLKYRGLVKYWFHSPPS
IPLQIEEYLKNPAQPILEALDKDSSPKDDAWDSVSIVSLPEKERDVLQSTLTQSTGPVQQ
PVGRGL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggagttgcgctaccggcagccgcccagttttggccggagtgtgatagtgggtgtgaaa
tcgtgtgaaacccagccccgcaggatggacatagacatctttgggggccattattctgcc
tacagcagggtcatactgttgagtacagtgcccagcactgggctgggtgccctgctggtt
gtcaccaggggctggggctgggtgactgccctcacccggcgctcaccccctggggtactg
cacagcctcccagaagcaggcctgccattctcagctcagtctggagatgtgctggaccac
ggcagccccaacaagccagatgggctgccccagagagctgcctgctgtcgtgctggccct
gtctgcctgcctctggccctggcttccatgaggcccgaatcgacttttctccttttgacc
ctccctttcgctcccacctctccctccttctcttattctctctgtccctttcaagaccct
ctttcgcagctgcctgctccacagaacccgaagattcacctgtataatgctgagcaggtt
ctgagttgggagccggtgtccctgagcaatgacacgaggctggtggtctaccaggtgcag
tttaaatactccatcagcagcaggtggtatgatgtcagtgttgatgacatcggggtgaac
tgtatgaacctcaccacgaccacgtgtaacttcaccccaaccagcctctcaaaggggttc
ccaccgcatttcaacgtctctttacgtgttcgagctaagctgagagacctggtttctgcc
tggctcacagtgccatggttccagtactgtcggaatgttaccgtcgggcctccagggaac
atctgggtgacccccagagaaggctccctcatcgtcaggctctcctctcccttcagcatc
gaggcctccatggccacttttttgtattatgtccattactgggaaaaaacaggaagacaa
caggttaaaggcccttacaggagcaactccattgtgttgaatgatttaaaacccttaaga
gtgtactgtttacaagtcaaggcacagctgttttggacaattgaaaacatctctagacct
ggacatttaagcaacatatcttgctacgaaacaacagcagatgcctctaccaagcttcag
caagtcatcctgatcgccgtggtgacctttctgttacttttggccctggcaggggcctgt
ctctccctggtcctgaagtacagaggcctggttaaatattggtttcactctccgccaagc
atcccgttacaaatagaagagtatttgaagaacccggctcagcctatcctagaggccttg
gacaaagacagctccccgaaggatgatgcctgggactctgtgtccatcgtttcccttcca
gagaaggagagagatgttctccaaagcactttgacccaaagcactggtccagtccagcag
cctgtgggaagaggactctga

KEGG   Manis javanica (Malayan pangolin): 108386976
Entry
108386976         CDS       T06054                                 

Definition
(RefSeq) interleukin-13 receptor subunit alpha-1-like
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108386976
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108386976
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108386976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108386976
   04090 CD molecules [BR:mjv04090]
    108386976
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108386976
CD molecules [BR:mjv04090]
 Proteins
  108386976
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind
Other DBs
NCBI-GeneID: 108386976
NCBI-ProteinID: XP_017500614
LinkDB
Position
Unknown
AA seq 259 aa
MGAGGCPHDAPRSAAAASRARIDRGTEERRVFSGFREAAVAALGQGADDLSLHFPCAFGK
SQGTRRRGEVPKHARGVGGRQSKLQFQLFSVRPQGNNKSCQISFLVFLWKNYKNYYQVLL
ASPIKEFQLPVTNLSVSVENLCTVIWTWNPPEGVGPNCSLSYFSHFGNKQDKKIAPETHR
SKEVPLNERICLQVGPQCSTNESDSPSNLEEKCISPPEGDPESAVTELQCIWHYMKLMNC
TWLPGRKTSPDTNYILYYW
NT seq 780 nt   +upstreamnt  +downstreamnt
atgggcgctgggggatgtcctcatgacgccccgcgctcggcggccgcagcctcccgcgcc
cgaatcgaccgggggaccgaggagcggagggtcttttccggattccgggaggcggcagtg
gcagcattggggcagggggctgacgacttgtcgctgcactttccttgcgcctttgggaaa
agccaaggaaccaggcgccggggagaggtaccaaaacacgcccgcggcgtcggagggcga
cagtcaaagctgcagttccagctgtttagtgtcagacctcaggggaacaacaagagctgt
caaatctctttcctagtatttctttggaaaaattataaaaactattaccaggttctgtta
gcaagcccaatcaaagaatttcagctacctgtgacaaacttgagtgtttctgttgaaaac
ctctgcacggtaatatggacatggaatcctcctgagggagtcggcccgaattgtagtcta
tcatattttagtcattttggcaacaaacaggataagaaaattgctccagaaactcatcgt
tcgaaagaagtgcccctgaatgagaggatctgtctgcaagtggggcctcagtgtagcacc
aatgaaagtgacagtcctagcaatttagaggaaaagtgcatctcgcctcctgaaggtgat
cctgagtccgctgtgactgagctgcaatgcatttggcactacatgaagctcatgaattgt
acttggcttcctggaaggaaaacaagtcctgacactaactacattctctactattggtga

KEGG   Manis javanica (Malayan pangolin): 108387774
Entry
108387774         CDS       T06054                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108387774 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108387774 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108387774 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108387774 (IL22RA1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108387774 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind HflK_N
Other DBs
NCBI-GeneID: 108387774
NCBI-ProteinID: XP_017501621
LinkDB
Position
Unknown
AA seq 574 aa
MRTLLTILAAAAGSLVAYIAEDTSDLLQQVKFQSSNFENILMWDSGPETPQDTVYSVEYK
KYGEREWLVKEGCQQITRRFCNLTMETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQH
TTIKPPDVTCTPKVRSIHMVVHPTPTPIHAGDGHRLTLEDIFHDLFYHLELHINHTYQMH
LGGKQREYEFIGLTPDTEFLGTIVIFVPTWSKESAPYMCRVKTLPDRTWTYSFSGAFLFS
MGFLVAGLCFLSYRYVTKPPPPPNSLNVQRVLTFQPLRFIREHILIPVFDPSGPGSLAPP
IQYSQVKVSGPREPSEAPPRHSRSEVTYLGQPDISILQPSSVPPPQTLSPLSYAPQAVPE
VKPPSYAPQVTPEAAPPVYSPQAISEVQPPSYTPQVTPDSWPLSYGMCMEGSSKNSPPVA
LSSPKHLRPKAELQKETPAGNYIPGGLSLQGVISLDLEEPGEAKSFHQPLGVHMDRGEPG
TPGCLKGQLPLLSSVQIEGQPMSLPLHTPSLPCSAADQGPSPWGLLESLVCPGDEGPMPE
AEAQRPGPRPSDLEQPPELDSLFRGLALTVHWEP
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgaggacactactgaccatcctggctgcagctgcaggatccctggttgcttacatcgct
gaggacacttcggatcttcttcaacaagtgaaattccagtccagcaacttcgaaaacatc
ttgatgtgggacagcgggccggagaccccccaagacacggtctacagtgttgagtataag
aagtacggagagagagagtggctggtgaaggagggctgccagcagatcactcggaggttc
tgcaacctgaccatggagacgggcaacctcacagagctctactatgccagggtaactgcc
gtcagcgcgggaggccggtcagccaccaagatgaccgaccgtttcagctcactgcaacac
actaccatcaaaccacctgatgtgacctgtactccaaaggtgagatccatccacatggtt
gtccatcccacccccacgcccatccacgcaggggatggccaccggctaacccttgaggac
atcttccatgacctattctaccacttagagctccacatcaaccacacctaccaaatgcac
cttggagggaagcagagagaatacgagttcattggcctgactcctgacacagagttcctt
gggaccatcgtgatttttgttccaacctggtccaaagagagtgccccctacatgtgccgg
gtaaagacgctgccagatcggacttggacctactccttctcgggtgccttcctgttctcc
atgggcttcctcgtcgcagggctctgcttcctgagctacagatatgtcaccaagccgcct
ccccctcccaactccctgaatgtccagcgcgtactgaccttccagcctctgcggttcatc
cgggagcacatcctgatccctgtctttgacccgagcggccccggcagtctggccccgccc
atccagtactcccaagtcaaggtctccgggcccagggagccctcagaagccccaccacgg
cacagccggtctgaggtcacctaccttgggcagccggacatctccatcctccagccctcc
agcgtaccgcctccccagacactgtccccactgtcctatgctccccaggctgtccctgag
gtcaagcccccatcgtatgcaccgcaggtcaccccggaagccgcacccccagtctatagt
ccacaggccatctctgaggtccagcctccttcctatacccctcaggtcactccagacagc
tggcctctttcctatgggatgtgcatggaaggatctagcaaaaactccccacctgtggcc
ctctctagtcccaaacacctcaggcctaaagctgagctccagaaagagacaccggctgga
aactacatcccaggcggcctttccctgcagggggtgatctccttggatctggaggagcca
ggagaagcaaaatccttccaccagcctctgggggttcacatggacagaggggagccaggg
acaccagggtgcctaaagggccagctgcccctcctctcctctgtccagatcgagggccag
cccatgtctctccctctgcacactccttctctcccgtgttccgcggctgaccaggggcca
agtccctggggcctgctggagtccctcgtgtgtcccggtgatgagggtcccatgcctgag
gctgaggctcagaggccaggccctcggccctctgacctggagcagcccccagagctggac
tccctgttcagaggcctggccctgacggtgcactgggagccctga

KEGG   Manis javanica (Malayan pangolin): 108387775
Entry
108387775         CDS       T06054                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 isoform X1
  KO
K05140  interferon lambda receptor 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108387775 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108387775 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108387775 (IFNLR1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108387775 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 108387775
NCBI-ProteinID: XP_017501622
LinkDB
Position
Unknown
AA seq 504 aa
MTSLSTTGRPHLAPPQNVSLLSRNFSVYLTWLPGPGNPQNVTYSVAYQSSSNPRRWRKVG
KCLGIQELACSLMCLEKQDLYNKFKGRVQAVSLHARSPWVESEYLDYLFEVEPAPPALVV
MRTEEILSISATYQLPLCMPAPDLKYEVDFWKEGTGNKTRFPVTPHDQPVHIPLQPAASG
HHCLSARTIYTFGNPKYSEFSKPTCFFLEAPGASWAFLVLLPLLGLLLLVIATGRVIWKS
FTGNPWLQRAKTPRALDFSGHRHPVATFQPRGPESPDDLVLCPQKELTRRVPLSPGVRAP
ATVQAASQGSAEEKDDEADAGGSLSFQPYSEPPPFLRRVHRLPGHAEAGGPWAPLVRVRG
SPVWDSSGGSWASPVGSSPWDEAGSSASLAKKGPGPGPGGDRCQEHLPLPQFSEDSDSLK
EPPKDDFSWTNWDSSRELHLDPGKPPVSLQTLIFWDSCSEEEEEEEEEGGRESEIENSST
GSCRAGSLPRTEVRGGMPGCYMAR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgacctctctctccaccacagggcgaccccatctggcccctccccagaatgtgtcgctg
ctctcccggaacttcagtgtgtatctgacctggctcccaggccctggcaacccccagaac
gtcacctattccgtggcttatcaaagctcttcaaaccccagacggtggcggaaagtggga
aagtgtctgggaatccaagagctggcatgttctctgatgtgcctggagaaacaagacctg
tacaacaagttcaaggggcgtgtgcaggcagtatctctccacgccaggtctccctgggta
gagtctgagtacctggattacctttttgaagtggagccggccccgcccgccctggtagtc
atgcggacagaggagatcttgagcatcagtgccacataccagctacccctctgcatgcct
gcaccggatctgaagtacgaagtggatttctggaaggaggggactgggaacaagacccga
tttccagtcactccccatgaccagccagtccacatccccctccagccagcagccagcgga
caccactgcctcagcgccagaaccatctacacctttgggaaccctaaatacagcgagttc
tccaagcctacctgcttcttcctggaggccccaggagccagctgggcattcctggtgctg
ctaccacttctggggctactgctgttggtcattgccaccggccgtgtgatctggaagagc
ttcacaggaaatccttggcttcagcgggcaaagacgccacgggccctggacttttctgga
cacagacaccccgtggcaacctttcagcccaggggcccagagtccccagatgacctggtc
ctctgcccgcaaaaggaactgaccagaagggtccctctgagccctggagtcagggcccca
gccaccgtccaggcggcatcacagggcagtgctgaggagaaggatgatgaggcggatgcg
ggcggcagcctcagcttccagccctacagtgaaccaccccccttcctccggcgggtgcac
cggctccccgggcatgctgaggcaggggggccctgggctcctctggtccgggtcagaggc
tcccctgtttgggattcttcaggtggaagctgggccagccctgtgggctcctccccctgg
gacgaggctgggtcctctgcttctttggccaagaaggggccgggcccagggccaggtggg
gacaggtgtcaggagcatctcccactacctcaattctctgaggactcggattccctgaaa
gagcccccgaaagacgacttctcctggaccaactgggactcatcacgggagctgcatctg
gaccctgggaagcccccggtttctcttcagacactgatcttctgggacagctgctcggag
gaagaggaggaagaggaagaagagggtgggagggagtcagaaattgagaatagcagcact
ggcagctgccgggccgggagtctcccaaggaccgaggtcagaggtgggatgccaggctgt
tacatggccaggtga

KEGG   Manis javanica (Malayan pangolin): 108389002
Entry
108389002         CDS       T06054                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108389002 (IL3RA)
   04151 PI3K-Akt signaling pathway
    108389002 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108389002 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108389002 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108389002 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389002 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108389002 (IL3RA)
   04090 CD molecules [BR:mjv04090]
    108389002 (IL3RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108389002 (IL3RA)
CD molecules [BR:mjv04090]
 Proteins
  108389002 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 108389002
NCBI-ProteinID: XP_017503083
LinkDB
Position
Unknown
AA seq 486 aa
MAWLWLSVVLAPVSALLPTNQDPESPIKNLMMEPRNRTLTWDLNGNVSKIECALHSGYIT
KAKNNRYCQLYMVPSCEVTNYSVTVTMTTGQLFSTSILYPVQEGNPRAAAQHLTCWVHDV
DFLTCHWVVGPEAPDDVQYRLYVEDLETYAQWECPHYGEDLRGTHVRCYFDVTGLFKDFH
FLVKGASRGSNFHFLRLGLLFKDFHFLVKGASRGSSIPCSELYVDLMESERLRLPNITGR
CNKSLSIMEWKMTSHFNDRFVYKLQIEKGSDPPYTENLVSENSFVLYNPGIYTVRLQAKG
AFQNVWSEWSAPQHFASLWDQLPGFLAITLAGCTYLKTHVHFLGTPGSRPLRPPEPSLGP
FHRAFPVGLIPQLPTTTLGLPALLGFEELAIAQTLSHQDKSFMSEDALGRAWLAPSLLAL
GTLLALGLAFVICARYSVMRRLLPPIPRVKDPIGDSSQGDKMMVWEAGRDSQEDCAVAQV
QVVGET
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcctggctttggctgtccgtggttctggctccagtctccgctctgctgcccacgaat
caggatccagaatcaccgattaagaacttaatgatggagccaagaaatagaaccctgacc
tgggacctcaatggaaatgtttccaagatcgagtgtgccttacattcaggttacatcaca
aaggcaaagaacaaccgttactgccagctgtacatggttccctcctgtgaggtgacaaac
tacagtgtcactgtcactatgaccacaggtcagctgttctcaacgtcgattctgtatcct
gtgcaagaaggcaaccccagggcagccgcccaacacctgacctgctgggtccatgatgtg
gacttcctcacatgccactgggtggtggggccagaggcgccggatgacgtgcagtaccgc
ctctacgtggaggacctggagacgtatgcgcagtgggagtgcccacattatggagaagat
ctgaggggcacacacgtccgctgttatttcgatgtcaccgggctattcaaagatttccac
ttcctggtaaagggcgccagcaggggctccaatttccacttcctgaggctgggcctncta
ttcaaagatttccacttcctggtaaagggcgccagcaggggctccagcatcccctgctca
gaactctatgtggacttaatggaatctgagagactgaggctccccaacatcacaggaagg
tgtaataaatccctttctatcatggagtggaaaatgacaagtcacttcaatgacagattt
gtctataaacttcaaatagagaagggctcagaccctccctacacggagaacctggtctca
gaaaattcctttgtgctctacaaccccggaatctacacggtgaggctacaagccaaggga
gccttccagaacgtctggagtgagtggagcgccccccagcactttgcttccctctgggac
cagcttccaggctttctggccatcactctggcaggctgcacataccttaagacacacgtg
cattttctcgggacacctgggtcgaggcctctgaggccacctgaaccttccctcggcccc
tttcaccgtgccttccctgtgggactcattccccagctgcccaccaccaccctggggctg
cctgccctgcttggcttcgaggagctcgctattgcccaaactctcagtcaccaagataaa
tctttcatgtcggaggacgccctgggccgcgcctggctggccccgtcgctgctggcgctg
ggcacactgctggcgctggggctcgcgttcgtgatctgcgcgaggtactcggtgatgcgc
aggctcctcccgcccatcccccgcgtgaaggaccccatcggggacagctcccagggcgac
aagatgatggtctgggaggccggcagggacagccaggaggactgtgctgtggcccaggtg
caggtcgtgggggagacgtga

KEGG   Manis javanica (Malayan pangolin): 108389086
Entry
108389086         CDS       T06054                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108389086 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108389086 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108389086 (CRLF2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108389086 (CRLF2)
SSDB
Motif
Pfam: IL6Ra-bind
Other DBs
NCBI-GeneID: 108389086
NCBI-ProteinID: XP_017503182
LinkDB
Position
Unknown
AA seq 370 aa
MWAVFPARVAAAVFLLGYFIALEETDLEEELQLQIINFNYENVWVTWNASKYPGTNLTFF
YKLTSDDEYGQCPDYIHREGHTAGCLLQAVEDEILHFYIFNGTHLLLSRAQWTSTYLKPS
SPKDLAFRWHQEAVTVTCPDLLYKDLLYEMQFKSIFDAEWQSAEENTCNVTIQGLDAEKC
YLFRARVKTEEPSYGPDTYPSDWSVVARWQRGELRDSCMEEKHFPKFILISSMVAILTLS
LLLLSLWKIYRVKKLLMPSVPDPKFTFPGLFECHQGNFQEWIKDTQNVAHVDNKEGVEQV
YVSEEALVVQLAKAEAEMPTMTASPLCPRTGQEEDCGDPRQHSCQPPQTGKVVSLGGFTF
VTSDNSYVML
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtgggctgtctttccagcccgggtggccgcagccgtgttcctgctgggatatttcata
gccttggaggaaacagacctggaagaagaattacagcttcagattatcaactttaattat
gaaaatgtttgggtcacttggaatgcaagcaaataccctggtacgaatttgacgtttttc
tacaaattgactagtgacgatgagtatggccaatgccctgactacattcaccgagaaggt
cacactgctgggtgcctcctgcaggcagtggaagatgaaattctgcatttttacatcttt
aatggaacacaccttcttctctccagggctcaatggactagcacttacctgaaacccagc
tccccaaaagatctggccttccggtggcaccaggaagcagtcacggtgacgtgtcctgat
cttctctacaaagatctcctatatgaaatgcagttcaaaagcatctttgacgccgagtgg
cagtccgcagaggagaatacctgcaatgttaccattcagggactggatgctgagaagtgt
tatttgttccgggccagagtgaaaaccgaggagcccagctatggcccggacacctaccca
agcgactggtcggtggtggcacgctggcagaggggcgagctgagagattcgtgcatggag
gaaaagcatttcccaaaatttattttgatttctagcatggttgccatcctgacactgtct
cttctcctactgtccttatggaaaatctacagggttaagaagctcctcatgccaagtgtg
ccggatcccaaattcaccttccctgggctctttgagtgccaccaaggaaatttccaggag
tggatcaaggacacccagaacgtggcccacgtggataacaaggaaggtgtggagcaggtg
tatgtctcggaagaggccctggtggtccagctggccaaggctgaggctgagatgcccaca
atgacagccagcccgttgtgcccacggacagggcaggaagaggactgtggcgaccccagg
cagcactcgtgtcagcccccccaaactggcaaggtggtctctctcgggggctttaccttt
gtgacaagtgacaactcatatgtgatgttataa

KEGG   Manis javanica (Malayan pangolin): 108389768
Entry
108389768         CDS       T06054                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108389768
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108389768
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108389768
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108389768
   04090 CD molecules [BR:mjv04090]
    108389768
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108389768
CD molecules [BR:mjv04090]
 Proteins
  108389768
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 108389768
NCBI-ProteinID: XP_017503752
LinkDB
Position
Unknown
AA seq 403 aa
MAAVLHFTTFLVLLSSACCRDPQLVQEDASPIINMKLDSRTRTLTWNYVRNVTEQECRLD
TPQGSPTMQSPRVKENNTYFCVFSNSVLHRGATLTLNVTSAGTAFQDVLNFTNPGKEGSS
AVNFSCFIYDVRFMNCSWTPGPAAPADVQYHLYAWASTNEDEAECPHYTTDSTGTRVGCH
FHKLGKPKRTDNYFFLVNGTSRETAVQFLDFTPFVAYKIEKYNPPENITVYDNESHHIIQ
WDNPEIRFDIATHMLYYKLDIQKKGSNSKIDPIFQRGEDKNVYLLPSSAMRAESTFRARV
RYVHNKLWSEWSSPLHFGHAELRSSRTTAALAGLVAGVVLTVTVLMFLCKRFSLKQRLLP
PIPQVRREVTGSLPPHLEVFWDGDSPPPGSHKPEDILLVEETQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccgctgtgctgcatttcacaacctttctggtgctactgagctcagcatgttgcaga
gacccccagctggtccaggaggacgcgtctcctattatcaacatgaagctagattccagg
acaaggacgttgacgtggaattacgtgagaaacgtgaccgagcaggaatgcagactagac
accccgcagggctcccccaccatgcaaagtccacgggtcaaagaaaacaacacctatttc
tgtgtattttccaactccgtgctgcacaggggggccaccctgacgctgaacgtgacttct
gctgggactgcattccaggatgtcctgaactttaccaacccaggcaaggaaggttccagt
gctgtgaacttctcctgctttatttacgacgtccgcttcatgaattgcagctggactccg
ggcccggctgcccctgccgacgtccagtaccacctctacgcatgggcttccacgaacgag
gacgaggccgaatgcccccactacaccacagactccacggggacgcgcgtgggctgccat
ttccataaactcgggaagcccaaacgcacagataattacttcttcttggtgaacggaacc
agcagagagacggcagtccagtttttggactttactccgtttgtagcttataaaatcgaa
aagtataacccaccagaaaacatcacagtttatgacaatgaatcacatcacattatccag
tgggacaatcctgagataagatttgacattgcaactcatatgttgtattacaaactggac
attcaaaaaaagggcagcaactctaaaatagatcctatcttccaacgaggggaggataaa
aatgtgtacctgctgcccagctctgccatgagggctgagagtacctttcgagcaagagtg
aggtacgtgcacaacaagctctggagtgagtggagctcgcccctgcatttcggccacgca
gagttgcgttccagcaggaccaccgcggccctggctgggctggtggcgggggtggtgctg
actgtcaccgtcctgatgttcctctgcaaaaggttctccctgaagcaaaggctgttgccc
ccgatcccgcaggtgcgcagggaagtcacaggcagcctcccgccccacctggaggtgttc
tgggacggggacagcccgccgccgggctcacacaaacccgaagacatcctcctggtggag
gagacgcagtga

KEGG   Manis javanica (Malayan pangolin): 108389965
Entry
108389965         CDS       T06054                                 

Gene name
CSF2RA
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108389965 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108389965 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108389965 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389965 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108389965 (CSF2RA)
   04090 CD molecules [BR:mjv04090]
    108389965 (CSF2RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108389965 (CSF2RA)
CD molecules [BR:mjv04090]
 Proteins
  108389965 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 108389965
NCBI-ProteinID: XP_017503992
LinkDB
Position
Unknown
AA seq 435 aa
MLEPQGTAKDSGLMGSLAQWALPSPSASPVGPLATAFLLSLFLHPASLLTQEHRDFPAVE
PIPSLKMKFDPRRMTLTWDCQENATYVECVMFHKEKGPITIMLTDKECRCKFPDSSLHGG
VTLMVTANISQRLISEKLVYPNPGEEGTAAQNFSCSIYNAYFMNCTWAKGQAAPDDVQYF
LYIRDSRRKIERECPHYVEDLKIHVGCHLKDLSGLTFHNYFLVNGTSQRTRIQFFDSILS
LKAIERYSPPHNVTVHCNGSHCLIRWEKPRTLQSLTGWEFQYQLDIQRQSTTQHSGNQLI
EVSGDAENKYNFPSPQPRGKHAVRVRTSDSRIQQWSAWSRPVEFGSEETEASLVHVYVLV
VLGTLACALLLGCLLKRVIGKYKLFPPIPRIKDKLTDNHQSNQQMIWEKFPPSAGRGDNE
EVLTVEEVTEAPTSP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgttggagccccagggaacagcgaaggacagcgggttgatggggagcctggcgcagtgg
gcacttccttctccatcggccagccccgtgggccccctggcgacagcctttcttctgtct
ctgttcctgcacccagcgtcccttctgacccaggagcaccgggattttccagcagtagag
ccgatccccagtctaaagatgaagttcgaccccaggagaatgacgttgacttgggactgc
caagaaaatgccacctacgtggaatgtgtgatgtttcacaaggaaaaaggaccaatcaca
ataatgcttacggacaaagaatgtcgctgcaaatttccagactcttctctccatggaggt
gtcacactcatggttacagcaaatatcagccaaagactgatctcagaaaagctggtctac
cctaacccaggtgaggagggcacagctgcccaaaacttctcctgttctatctacaatgca
tatttcatgaactgcacttgggcaaagggtcaagcagcccccgatgatgtccaatatttt
ttatatatacgagactccaggagaaaaatcgaaagagagtgtcctcattatgtagaagac
ttgaaaatccacgtgggatgtcacctcaaagacctctcgggattaactttccataattat
ttcctggttaatggtaccagtcaaagaacaagaatccagttcttcgattccattttgtca
ttaaaggcaatagagagatacagcccgccccacaatgtcaccgtgcactgcaacggatcg
cactgcctcattcgctgggagaagcccaggaccctgcagagcctgaccggctgggagttc
cagtaccagctggacattcagaggcagagcaccacgcaacatagtggaaatcagctgatt
gaggtgtctggtgatgcagaaaataaatacaactttccgagcccgcagcccagggggaaa
catgcggtgagggtgaggacctcagactcgcggatccagcagtggagtgcgtggagcaga
cccgtggagttcggctccgaggaaacagaagccagcctcgtgcacgtgtatgtgctggtg
gtcctgggaaccctcgcatgcgccctgctgctcggctgccttttaaaaagggtcattggg
aagtacaagttatttccaccgattccacggatcaaagataaactgacggataaccatcag
tccaaccagcagatgatctgggagaagttcccacccagcgcaggcagaggggacaatgaa
gaggtcttaacagtggaggaagtgacggaggcccccacaagcccctga

KEGG   Manis javanica (Malayan pangolin): 108390189
Entry
108390189         CDS       T06054                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390189 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390189 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108390189 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108390189 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108390189 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108390189 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108390189 (IL10RA)
   04090 CD molecules [BR:mjv04090]
    108390189 (IL10RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108390189 (IL10RA)
CD molecules [BR:mjv04090]
 Proteins
  108390189 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 108390189
NCBI-ProteinID: XP_017504410
LinkDB
Position
Unknown
AA seq 562 aa
MVPRLVVLLAALLGSRAQELPRPPSVWFEAEFFHHTLHWMPIPNQSESTLYEVELLRYGT
EAWTSIPSCSRTLVLSCDLTVATLDLYHSSGYRAKVRAADGSQYSNWTTTQTRFSVDEVT
LTVGSVTLKKHNGFLLGTIQPPRPKVAPAGDTYESIFPNFREYEIAVRKVPGNYTSPNKK
VKHENFSLPVPGEEGEFCVKVRPSVGSRLNKGLWSQEECCVLTPQYFTVTNLSIFFASVL
LLSGALAYCLALQLYVRRQGKLPAVLVFKEPSPFSLISQLPWPEARDAIHALDEEALPKV
FPELRNSELHGSTDSGFGSAKPSLQTEEPQFLLPAPQPQARGTLRQGAALGLESSSDSTD
SGICLQEPSLSPGPGPGWEQQEGSNSQGQDDSGIGLAQNSEGQPEDTQGGSALGHVNPPG
LEGPGEEDPAVVAFQGYLKQTRCTDALEEDFSLADGLGPKFRTCLDAEAGWPPPAPAKGY
LKQDPPGTTLTPSGAPAGQWNQPAKEWPLLGFPSGGDLGASDWSFAQDFGALDCGAAPGG
LLGSFDSDLVTLPLISSLNSNE
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggtgccgcgcctggtagtgctgctggcggcgctcctcggctctcgcgcgcaagaactg
ccccgccctccatctgtgtggtttgaagcagaatttttccaccacacactccactggatg
cccatcccgaaccagtctgaaagcaccctctatgaagtggagctcttgcggtatggaacg
gaggcctggacgtccattcccagctgcagccggaccctggtgctgtcctgcgatctcacc
gtggcgaccctcgacctgtaccacagcagtggttaccgagctaaagtccgggcagcagac
ggaagccagtactccaactggaccaccacccaaacccgcttctccgtggatgaagtgact
ctgacagttggtagtgtgacgcttaagaagcacaacggtttcctccttgggacaatccag
ccccccaggcccaaggtggcccctgcaggcgacacatatgaaagcatcttcccaaacttc
cgggagtacgagattgcagttcgcaaggtgccaggaaactatacgtccccaaacaagaag
gtaaaacatgaaaacttcagcctcccagtgcctggagaggagggagagttctgtgtcaag
gtgagaccgtccgtcggctcccgactgaacaagggactgtggtcccaggaggagtgctgc
gtgctcaccccacagtatttcactgtgaccaacctcagcatcttcttcgcctccgtcctg
ctgctcagcggagccctggcctactgcctggccctccagctgtacgtgcggcgccagggg
aagctgcccgcggtcctggtcttcaaggagcccagtcccttcagcctcatcagccagctt
ccctggccagaggccagagacgccatccatgccctggatgaggaggccctccccaaagtg
ttcccagagctgaggaactcggaactgcatggcagcactgacagtggctttggcagcgcc
aagccatccctgcagaccgaagagccccagttcctcctccctgccccccagccccaggcc
agggggaccctgaggcagggggcagccctggggctggagagcagcagcgatagcacggac
agcgggatctgcttgcaggagcccagcctgagtcccggcccggggcccggctgggagcag
caggaggggagcaacagccagggccaggacgacagtggcatcggcctagcccagaactcc
gaggggcagcctgaggacacacagggtggctcagccttgggccacgtcaaccccccagga
ctggaagggcctggggaagaagacccagccgtggtggcattccagggctacctgaagcag
acccgatgcacagatgcactggaggaagacttctccctagcagatggccttggccccaaa
ttcaggacgtgcctggatgccgaggcagggtggcctccaccagccccggcaaagggctat
ttgaaacaggaccccccaggaacgactctcaccccctcaggggcgccagcgggacagtgg
aaccaaccagccaaggagtggccgctcctgggctttcccagcggcggcgacctgggagca
tctgactggagctttgcccaggattttggcgctctggactgtggggcagctccaggtggt
ctcctgggcagttttgactcagacctggtcaccctgccattgatctccagtctgaactcg
aatgagtga

KEGG   Manis javanica (Malayan pangolin): 108390628
Entry
108390628         CDS       T06054                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390628 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390628 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108390628 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390628 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108390628 (IL5RA)
   04090 CD molecules [BR:mjv04090]
    108390628 (IL5RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108390628 (IL5RA)
CD molecules [BR:mjv04090]
 Proteins
  108390628 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind HOK_GEF
Other DBs
NCBI-GeneID: 108390628
NCBI-ProteinID: XP_017505307
LinkDB
Position
Unknown
AA seq 443 aa
MRSWPSPPEYGHWKREDHWKQDVIIMAPALLFLLGATAILQAHLLPDKKSVLLLPPVNFS
LTVTDLAQVLLRWEPNPDQEQRGVNLGYHVRIHTPQEEDYDTMNTASKRVAILHEGFSAS
VQTVPWDSHSLRPSCWVSAELKAPPGSPGTSVVNLTCTTNTMVNSHQHSRPYQVSLHCAW
LVGKDAPEDTQYFLYYRYGSWTEECQEYSKDTLKRNVACWFPRTFISSKGRDTLAVHVNG
SSKHAAIKPHDRLLALHAIDRVNPPMNVTAETEGTSLSIQWGKPVSAFPTHCFDYEVKIY
NIRKGYFQTEKMMTNTFTVVTDDISKYSIQVRATVSSVCRAVGLWSEWSQPIYVGNDEQK
PSTEWFLIVFMATICFTLLMFSLICRKCHLWTKLFPPVPTPKSNIKDFFVNINYEKSGSN
ETETEVISYMEEPGLEILEDSVF
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaggtcctggccctctccccctgaatacgggcactggaagagagaggaccactggaaa
caggatgtgatcatcatggcacctgcattattgtttcttttgggggccacagcgatactg
caagcacacttacttcctgataaaaaatccgttttgcttctcccacctgtcaacttcagc
ctcactgttactgacttagctcaagtgcttttacgctgggaaccaaatcctgatcaagag
caaaggggtgttaatctaggatatcacgtgagaatacacactccacaagaagaagattat
gataccatgaacactgcaagcaagcgtgtggccatccttcatgagggcttctcagccagt
gtgcaaaccgtcccatgggacagccactctctcaggccaagctgctgggtttctgctgaa
ctgaaagctccaccgggatctcctggaacctcagttgtgaatttaacttgcactacaaac
accatggtaaacagtcatcagcactcaaggccataccaagtttctcttcactgcgcctgg
ctcgttggcaaggatgcccctgaggacacgcagtatttcctctactatcggtatggttct
tggacagaagaatgccaagaatacagcaaagacacactgaagagaaatgttgcatgctgg
ttcccaaggacgtttatcagcagcaaagggcgggacaccctggcagtgcatgttaacggc
tcaagcaagcatgcggcaatcaagccccacgatcggctgcttgctcttcatgcaattgat
cgagtaaatcctccaatgaatgtcacagcagagactgaaggaacatctctctctatccaa
tgggggaaacctgtttctgcctttccaacccattgctttgattatgaagtaaaaatttat
aacataaggaaaggttattttcagacagaaaaaatgatgaccaatacattcaccgtggta
actgatgatatttctaagtattccattcaagtgagagcaactgtgagctccgtgtgcaga
gcagtggggctctggagtgagtggagtcagcctatttatgtgggaaatgatgagcagaag
ccctcaacagaatggtttcttattgtgtttatggcaaccatctgcttcaccttgttaatg
ttctcactcatctgtagaaagtgtcacttatggaccaagttgtttccaccagtcccaaca
ccgaaaagcaatattaaagatttctttgtaaacatcaactatgagaaaagtggttccaat
gaaacagaaactgaagtcataagttacatggaagagcctggactggagatcctcgaagat
tctgtgttctga

KEGG   Manis javanica (Malayan pangolin): 108392655
Entry
108392655         CDS       T06054                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108392655 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392655 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108392655 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108392655 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108392655 (CSF2RB)
   04090 CD molecules [BR:mjv04090]
    108392655 (CSF2RB)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108392655 (CSF2RB)
CD molecules [BR:mjv04090]
 Proteins
  108392655 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N EpoR_lig-bind fn3 IL2RB_N1 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 108392655
NCBI-ProteinID: XP_017508510
LinkDB
Position
Unknown
AA seq 902 aa
MALPQRLLSVALLAMYWGPSTAGAQETVPLQTLSCHNDYTSRIVCRWADTQDAQRLINVT
LYRRLNEGPPQPVSCSLSDDMPWLDAPCPGCVPRRCVIPYKLFVVADKDYFSFQPARTLE
TQLTVNLTQHVRPPTPEDFRITAAGDRFLLNWSVALAGSQSPWLSNLEFEVVYRRLQDSW
EDAPALYSRSSQAILGPEHLMPSSTYVARVRTRLARGSGLSGPPSKWSPEVRWDSQPGDE
AQPQNLQCFFDGAATLSCSWEVRAEVISSVSFTIFYKPSPNAAEKECSPVLKEASGSPYI
RHRCQIPVPDPRNHSQYTISVRPKKEEKFIKSSENIQMAHPTLNVTKGRDGYVLRWKAGE
MQYKHIAHAFQVQYKKEADSWEESKMEPLQNAHSMPLPPLEPSTRYEARVRVKPGPSGYS
GIWSEWSEECSWDTDWVLPTWALALTLVFTTLALLPALRFCGIHGYRLNQKWKEKIPNPS
KSHLFQNGNTGLRLPDSMLTLTSRSPPHKGLLGSHFPELEGVSSVDYGRSEVSPLTTEDP
KGARESPPEPDMTLATSDPPTEQPPSPKPGLSARPGKPESQVPGFDFNGPYLGPPQSRSL
PDMAGQRAPPQMGMSRKPQPSGSLEYLCLPAAGQVQLVPLSQVIGQGWARDVERRPSLGA
EGSPSLESGADPTPPAPGLMVGGQGPKDRHSPKDVVPPALPTGSGVPEDGIVASGYVTTA
DLALTPPTGSPPISQDPPLVLSFDENHSLSPGRAGGPTGALAAMRSEFEGYVELPPTTGQ
SLKSPLGSPAPPAASSPISSPGEPRADAAPASPNPEGLLVLQQVGDYCFLPGLGPGPLPA
QSKRSSSGPCPDLGDLAQEVQAKKALCQPLPQVPAIQLFKALKQPDYLPLPPWGVSRPEG
VC
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggcgctgccccagaggctgctctccgttgccctgctggccatgtactgggggcccagc
actgcaggggcccaagagacggtccctctgcagaccctgagctgccataacgactacacc
agccgcatcgtctgcaggtgggcagacacccaggatgcccagcggctcatcaatgtgacc
ctgtaccgcaggctgaatgagggccctccgcagccagtgtcctgcagtctcagtgacgac
atgccctggttagacgcaccttgtccgggctgtgtgcccagaagatgcgttattccctac
aagctttttgttgttgccgataaagactatttctcattccaaccagcccggactctggaa
acccagctcactgtgaatctgacccagcacgtgcggccccccacgcccgaggacttccgc
atcactgctgccggggaccgtttcctgctcaactggagtgttgccctcgcgggttcccag
agcccctggctgtcaaacctggagtttgaggtggtctacaggcggcttcaggactcctgg
gaggacgcccccgccctctactccaggtcctcccaggctatcctgggcccggagcacctc
atgcccagcagcacctacgtggcccgagttcgcacccggctggcccggggttcggggctc
tcgggtccgcccagcaagtggagccccgaggttcgctgggattcccagccgggggacgag
gcccagccccagaacctccagtgcttctttgatggggctgccacgctcagctgctcctgg
gaagtgagggccgaggtgatcagctcggtctccttcaccatcttctacaagcccagcccc
aacgcagcggagaaggagtgctccccagtgctgaaggaggcgtccggcagcccctacatc
cggcaccgatgccagattcctgtgcccgaccccaggaaccacagccagtacaccatctct
gtccggccaaagaaggaagagaaatttataaagagctcagagaacatccagatggcacac
ccaaccctcaatgtgaccaagggcagagatggctacgtcctgcgctggaaagcgggggaa
atgcagtacaaacacattgctcacgccttccaggtccagtacaagaaagaggcggactca
tgggaggagagcaagatggagcccctccagaacgcccacagcatgccgctgcctcctctg
gagccctccaccaggtacgaggcgagagtgagggtgaagcctggccccagcggctacagt
gggatctggagtgagtggagtgaggagtgctcctgggacacggactgggtgctgcccacg
tgggccctggcactcaccctggtcttcaccacccttgccttgctcccggccctacgcttc
tgtggcatccatgggtacaggctgaaccagaagtggaaggagaaaatccccaaccccagc
aagagccacttgttccagaatgggaatactgggctccggctcccagacagcatgctaacc
ctcaccagcaggagccccccgcacaagggcctgctcggcagccacttccctgagctggaa
ggggtgtcctctgtagactatggacgcagcgaggtgtcacctctcaccacagaggaccct
aaaggtgcccgtgagtcaccgcccgagccagacatgaccctggccacctcggaccctccc
acagagcagccccccagccccaagccgggcctgtcggccagaccaggcaagcctgagagc
caggttcccggcttcgacttcaatggcccctacctggggccgccacagagccgctccctg
cctgacatggcaggccagcgggcacccccacagatgggcatgagcaggaagccacagcct
tcagggtccctggagtacctgtgtctgcccgcggcgggtcaggtgcagctggtgcccctg
tcccaggtgataggacagggctgggccagggatgtggaaaggaggcccagcctaggggct
gaagggagcccctccctggagtcaggggcagaccccaccccacctgcacctgggctgatg
gtgggtggtcagggcccaaaagacagacacagcccaaaggatgtggttcccccagctctg
cccactggctctggggtccctgaggatggcattgtggcctctggttatgtcaccacggca
gacctggcactcaccccacccacagggtccccacctatctcccaggatccccctctggtc
ctctccttcgatgagaatcacagcctcagtcccgggcgggctggtgggcccactggagcc
ctggccgccatgaggtctgagtttgaaggctatgtagagctccctccaaccacaggccag
tccctcaagtcccctctgggcagtcctgcccctcctgcagccagcagccccatctcaagc
cctggggagccccgggcagatgcagccccagcctccccaaaccctgaggggctcctggtc
ctgcagcaagtgggtgactattgtttcctccctggcctgggacctggccctctcccagcc
cagagtaagcgctcttcctcaggaccctgtcccgacctcggggacctcgcccaggaggtc
caggccaagaaggccctgtgccagccccttccacaggtgccggccattcagctcttcaaa
gccctaaagcagccggactacctgcccctgcccccttggggtgtcagcaggcctgagggg
gtgtgctga

KEGG   Manis javanica (Malayan pangolin): 108392662
Entry
108392662         CDS       T06054                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108392662 (IL2RB)
   04151 PI3K-Akt signaling pathway
    108392662 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392662 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108392662 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108392662 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108392662 (IL2RB)
   04659 Th17 cell differentiation
    108392662 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108392662 (IL2RB)
   05202 Transcriptional misregulation in cancer
    108392662 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108392662 (IL2RB)
   05162 Measles
    108392662 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108392662 (IL2RB)
   04090 CD molecules [BR:mjv04090]
    108392662 (IL2RB)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108392662 (IL2RB)
CD molecules [BR:mjv04090]
 Proteins
  108392662 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N fn3
Other DBs
NCBI-GeneID: 108392662
NCBI-ProteinID: XP_017508527
LinkDB
Position
Unknown
AA seq 557 aa
MADPALSWHLSLLTLLLPLAIPRASAVMNADTSKLSCFYNSRANISCVWSQDGGQQATSC
HIHAQPDKRPWNKSCELLLVRPASWTCNLILGSPDSQTLTRADVVNMSVLCLEGKRWRMV
TTQDFKPFDNLRLMAPNSLQVTNLEIHRCNITWKVSQFSHYIERYLEFETQTRFPGHSWE
EKSLRRLRQNQHWIALETLTPDTLYEFQVRVRSQQGDRKTWSPWSEPLAFRTRPAAGPGR
KALTLPWLEHIFIGLSGALGFVILVCLLANCRYTGPWLKKVLKCHIPDPSEFFSQLSSEH
GGDFQKWLSSPFPSSSFSPSGVAPEISPLEVMDRDTKAAQLLLLQQDKVAPLPPSETSGH
SLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPGEGGPGAPEGSLLPPLLPPPGQ
DDAYCTFPPGDDLLFFSPSLLRGPGLSNTALGVPGAGEESLAPSLPEEAPQDEATQPLGP
QSPGAPDLVDSQPPLEHALGEAGGQVPAPGPGQGAGFPWASHLGRGQIRAPPSCLTLNTD
AYLSLQELQDRDPAHSV
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcagaccctgctctgtcctggcatctgtccctccttaccctcctgctgcccctggcc
atacctcgggcatccgcagtgatgaacgcagacacgtccaagctctcatgcttctataac
tcaagagccaacatctcctgtgtctggagccaggatgggggccagcaggccacgtcctgc
cacatccacgcccagccagataaacggccttggaacaagtcctgtgagttgctcctggtg
aggccggcatcctggacttgtaacttgatccttggatccccagattcccagacactgacc
agggctgacgtcgttaacatgagcgtgctgtgcctcgaagggaagaggtggagaatggtg
acaacccaggacttcaagccctttgacaaccttcgcctgatggcccccaactcccttcaa
gtcaccaacctagagatccacagatgcaacataacctggaaggtctcccagttctcccac
tatattgaaagatacctggaatttgagacccagacaaggttcccaggccacagctgggag
gagaaatccctgaggaggctcaggcagaaccagcactggatcgccctggagacactcact
ccggacacactgtatgaatttcaagtgcgggtcaggtcccagcaaggagaccgtaagact
tggagcccctggagcgaacctctggccttcaggacaaggcctgcagcaggccctgggagg
aaggctctgaccctcccttggctggaacacatcttcataggcctcagcggtgccttggga
tttgtcatcctagtctgcttgctggctaactgccggtacacggggccatggctgaagaag
gttctgaagtgtcacatcccagacccctctgagttcttttcccagctgagctcagagcat
ggaggagatttccagaagtggctctcctcgcccttcccctcgtcctccttcagccccagt
ggcgtggcgccggaaatctccccgctggaggtgatggacagggacaccaaggctgcacag
ctgctcctgctgcagcaggacaaggtggcgcccttgcccccatccgagaccagcggccac
tctctgaccagctgcttcaccaaccagggctacttcttcttccacctccctgatgctctg
gagattgaggcctgccaggtgtatttcacctatgacccctgcacagaggagcctggagag
ggtgggcccggagcacctgaggggtctcttctcccgcctctgctgcctccaccagggcag
gacgatgcctactgcaccttcccccccggggacgacctgctgttcttctccccaagtctc
ctcaggggcccaggcctctcaaacactgccctaggggtccctggggctggtgaagaaagt
ctggccccctccctgccagaggaagcaccccaagatgaagctacccagcccctggggcct
cagtccccaggagctccggacctggtggactcccagccaccgctggagcatgccctggga
gaggcgggagggcaggttcctgccccaggccctgggcagggggcaggcttcccctgggct
agtcatctcgggcgaggccagatcagggcccccccctcctgcctgaccctcaacaccgac
gcctacctgtccctccaggagctccaggatcgggacccagctcactcggtgtag

KEGG   Manis javanica (Malayan pangolin): 108393228
Entry
108393228         CDS       T06054                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108393228 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108393228 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108393228 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108393228 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108393228 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108393228 (IL6ST)
   05203 Viral carcinogenesis
    108393228 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108393228 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108393228 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108393228 (IL6ST)
   04090 CD molecules [BR:mjv04090]
    108393228 (IL6ST)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108393228 (IL6ST)
CD molecules [BR:mjv04090]
 Proteins
  108393228 (IL6ST)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N fn3_2 Interfer-bind DUF4921
Other DBs
NCBI-GeneID: 108393228
NCBI-ProteinID: XP_017509402
LinkDB
Position
Unknown
AA seq 750 aa
ATEKFADCKTKRGTPTSCTVDYSPVYFVNIEVWVETENALGKVTSNHINFDPVDKVKPNP
PHNLSVTNSEELSSILKLTWINSSVQSFIRLKYSIQYRTKDTSTWSEIPSEDTASTRTSF
TVQDLKPFTEYVFRIRCMKEDGKGYWSDWSKEASGITYEDRPSKAPSFWYKIEPSHSRGY
RSVQLMWKTLPLFEANGKILDYEVTLTRWKSRLQNYIVNDTKLQVNLTNDRYIATLTARN
LVGKSDASVLTIPPYGFQATHPIKDLKAFPKDNMLWVEWTAPNESVNKYVLEWCVLSDKS
PCIPDWQQEDGIVHHTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPT
VRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTS
DTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKR
DLIKKHIWPNVPDPSKSHIAQWSPHTPLRHNFNSKDHMYSDGNFTDVSVVEIEANEKKPF
PEDLKSLDLFKKEKISTEGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVH
SGYRHQVPSVQVFSRSESTQPLLDSEERLEELQLADSSDGILPKQPYFKQNCSQHETSPD
ISDFERSKQVSVNEDLVRLKQQQISDPIPQSYGSGEMKMFQEVSAADPFGPGTEGQVERF
EAVGMEAVIDEEMPKSYLPQTVRQGGYVPQ
NT seq 2254 nt   +upstreamnt  +downstreamnt
ggcaacagagaagtttgctgattgtaaaacaaaacgtggcacccccacctcatgcactgt
tgattattctcctgtgtattttgtcaacattgaagtctgggtagaaacagaaaatgccct
tgggaaggttacatcaaatcatatcaattttgatcctgtagataaagtgaagcccaatcc
accacataatttatcagtcaccaattcagaggaactatctagtatattaaaactgacatg
gatcaactcaagtgttcagagtttcataagactgaaatatagcattcaatataggaccaa
agatacatcaacttggagtgagattccatctgaagatacagcatccacccgaacttcatt
cactgtccaggaccttaaaccttttacagaatatgtatttaggattcgttgtatgaagga
agatggtaaagggtactggagtgactggagtaaagaagcaagtgggatcacatatgaaga
tagaccatccaaggcaccaagtttctggtataagatagagccatcccattctcgtggcta
tagatctgtgcagcttatgtggaagacattgcctctttttgaagccaatggaaaaatctt
ggattatgaagtgactctcacaagatggaaatcacgtttacaaaattatatagttaatga
cacaaaactgcaagtaaacctcacaaacgatcgttacatagcaactttgacagccagaaa
tctggttggcaaatcagatgcatctgttttaaccatccctccctatggctttcaagctac
tcaccctataaaggatcttaaagcatttcccaaagataacatgctttgggtagaatggac
cgctccaaatgaatctgtaaacaaatacgtacttgaatggtgtgtgttatcagataaatc
accctgtatcccagattggcaacaagaagacggtattgtacatcacacctatttaagagg
gaacctagcagagagcaaatgttatttgataacagttactccagtatatgctgatggacc
gggaagcccagagtctataaaggcataccttaaacaagctccaccttccaaaggacctac
tgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggaccaacttcctgt
tgatgttcagaatggcttcatcagaaattatactatattttatagaaccatcattggaaa
tgaaactgctgtgaatgtggattcttcccacacagaatatacactgtcctctttgactag
tgatactttgtacatggtacgaatggcagcatacacagatgaaggtggaaaggatggtcc
agaattcacttttactacaccgaagtttgcccaaggagaaattgaagccatagttgtgcc
tgtttgcttagcattccttttgacaacccttttgggagtattgttctgctttaataagcg
agacctaattaaaaaacacatctggcctaatgttccagatccttcaaagagtcatattgc
ccagtggtcacctcacacacctttaaggcataattttaattcaaaagatcatatgtactc
agatggcaatttcacggatgtaagtgttgtggaaatagaagcaaatgaaaaaaagccttt
tccagaagatctgaaatcattggacctcttcaagaaagaaaaaattagtactgaaggaca
cagtagtggtattggagggtcttcgtgcatgtcatcttctaggccaagcatttctagcag
tgatgaaaatgaatctgcccaaaacacttcaagcactgtccagtattccactgtggtaca
tagtggctacagacaccaggtgccatcagttcaagtcttttcaagatccgagtccaccca
gcccttgttagattccgaagagcggctggaagagctacagctagcagatagcagtgatgg
cattttgcccaagcaaccgtatttcaagcaaaactgcagtcaacatgaaaccagtccaga
tatttcagactttgaaaggtcaaagcaagtttcagtcaatgaagatcttgttagacttaa
acagcagcaaatttcagatcctattccacagtcctatggatctggggaaatgaaaatgtt
tcaagaagtgtctgcagcagatccttttggtccaggtactgagggacaagtagagagatt
tgaagcagttgggatggaggctgtgattgatgaagaaatgcctaaaagttatttaccaca
gactgtgagacaaggtggctacgtgcctcagtga

KEGG   Manis javanica (Malayan pangolin): 108393777
Entry
108393777         CDS       T06054                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108393777 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108393777 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108393777 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108393777 (IL20RB)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108393777 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 LapA_dom
Other DBs
NCBI-GeneID: 108393777
NCBI-ProteinID: XP_017510338
LinkDB
Position
Unknown
AA seq 305 aa
MVLEEILTSLTICFFYALMPCLLIGGVVVLPAPQNLSVQSVNMKHLLTWSPVIVPGEIVY
YSVEYQGEYESLYMSHIWIPSSWCSPTKGPECDITDDITATVPYNLHVRATLGSQTSAWS
TLQHPFNRNSTVLTPPGMDITKDGFHLVIELEDLGPQFEFLVVYWRREPSAKEHVKMVRS
GAVPVHLETMEPGAAYCVKAQTLVKAIGRHSTFSRAQCVKVQGEPLPLALALFAFVGFLL
ILVAVLLSIWKMGRLLRHSCCPVVVLPNTLKITSSPQKLISCRREEAEACTTAVLSSEEL
LRPWI
NT seq 918 nt   +upstreamnt  +downstreamnt
atggttctagaagaaatcttgacaagtcttaccatatgctttttctacgccttgatgcca
tgtttgctcataggtggagtggtggtcctgcccgcccctcagaacctctctgtacagtca
gtcaacatgaagcacctcctgacgtggagcccggtgattgtgcccggagaaatagtatac
tattctgtcgagtaccagggagagtacgagagcctgtacatgagccacatctggatcccc
agcagctggtgctcacccaccaaaggccctgagtgtgacatcaccgatgacatcactgcc
actgtgccgtacaacctccatgtcagggccaccctgggctcgcagacctcagcctggagc
accctgcagcacccctttaatcgaaactcaactgtcctcaccccgcctgggatggacatc
accaaggatggcttccatctggttattgagctggaagacctggggccccagtttgagttc
ctcgtggtctactggaggagagagcccagtgccaaggagcatgtcaagatggtgaggagc
ggggctgttccagtgcacctggaaaccatggagccgggggctgcgtactgtgtgaaggcc
cagacactggtaaaggccatcggaaggcacagcaccttcagccgggcacagtgtgttaag
gtgcaaggagagcccctcccgctggcgctggccctgtttgcgtttgttggctttctgctg
atcctggtggctgtgctgctctccatttggaagatgggccggctgctccgccactcctgt
tgccccgtggtggtgcttcccaacaccctgaaaataaccagttcacctcagaagttaatc
agctgccgaagggaagaggcggaggcgtgcaccacagccgtgctgtcttctgaggaactc
ctcaggccctggatctag

KEGG   Manis javanica (Malayan pangolin): 108393946
Entry
108393946         CDS       T06054                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04066  HIF-1 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04659  Th17 cell differentiation
mjv04932  Non-alcoholic fatty liver disease
mjv05163  Human cytomegalovirus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108393946 (IL6R)
   04066 HIF-1 signaling pathway
    108393946 (IL6R)
   04151 PI3K-Akt signaling pathway
    108393946 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108393946 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108393946 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108393946 (IL6R)
   04659 Th17 cell differentiation
    108393946 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108393946 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108393946 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108393946 (IL6R)
   05163 Human cytomegalovirus infection
    108393946 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108393946 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108393946 (IL6R)
   04090 CD molecules [BR:mjv04090]
    108393946 (IL6R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108393946 (IL6R)
CD molecules [BR:mjv04090]
 Proteins
  108393946 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig Ig_5 I-set Ig_4
Other DBs
NCBI-GeneID: 108393946
NCBI-ProteinID: XP_017510637
LinkDB
Position
Unknown
AA seq 486 aa
MTNQDGISVSAQPYPVNDSTGTDGTSSALTVEDILGGLFQDGVFLSSGPELASDVLSSLL
ESTVTLTCPGGDQEDNATIHWVYRNQVANSHGDRLVGEGRGLLLRSVQLHDSGNYSCYQD
GRPAGSVHLLVDAPLEEPQFSCSRKSPIVNVLCEWTPQSPPSPSTRAVLLLRKFPLEEFQ
RPCKYSPETQKFSCQLVVPEGDNSFYIVSLCVTNSIGSKLSKAQTFEGYTVLQPDPPVNI
TVTAVDRKPRWLNVTWEYPPSWNSYFYRLRFELRYRAERSKTFTVWMAKDFQNYGVINDA
WRGMRHVVQIRAQEEFGHGDWSEWSQEAMGTPWIESRTSPAETMVSLSTQAPTTTEDDEN
TLPKDSANATSFPVQDSSSAALPTYLVVGGSLAFGTLLCIGIILRFKKTWKLQALREGKT
NMHPPYSLGQLVSERPKPTPVLVPLISPPVSPSSLGSDNISRHSRPDARGPQSPYDISNR
DYFFPR
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacaaatcaagatggcatttcggtgtcagcccaaccctatccagttaatgactcaact
gggacagacgggacatcaagtgctttgacagtggaggacattttgggaggtttgtttcag
gacggtgtctttctgagctcaggcccagagttggcgagcgacgtgctgagcagcctgttg
gagtccaccgttaccctgacctgcccaggtggggatcaggaagacaatgccaccattcac
tgggtgtacaggaatcaggtcgcaaactcacatggggacagactggttggcgagggaagg
gggctgcttctgaggtcggtgcagctccatgactctggaaactattcgtgctaccaggac
ggccgcccggctgggagtgtgcatctgctggtggatgcccctcttgaagagccccagttc
tcctgctcccggaagagccccatcgtcaatgttctttgtgagtggacccctcagagcccc
ccgtcgccgagcaccagggctgtgctactgttgaggaagtttcccttggaagaattccag
aggccatgcaagtattctccggagacccagaagttctcttgccagttggtggtcccagag
ggagacaactctttctacatagtgtctctgtgtgtcaccaacagtattgggagcaagctc
agcaaagcccaaacatttgaggggtacacagtcttgcagcctgacccacctgtcaacatc
acagtcactgctgtggaccggaagccccgctggctcaatgtcacctgggaataccccccc
tcctggaactcatatttctacaggctgcggtttgagctccggtaccgggctgaacgatca
aagacattcacagtgtggatggccaaggacttccagaattatggagtcatcaacgatgcc
tggaggggcatgaggcacgtggtgcagattcgggcccaggaggagttcgggcatggcgac
tggagcgagtggagccaggaggccatgggcaccccttggatagaatccagaacttctcca
gctgagaccatggtgtccctctccacccaggcacctactactactgaagatgacgaaaat
actctccctaaagattctgcaaatgcaacaagcttcccagtgcaagattcctcttcggct
gcactgcccacttacctggtggttggcggaagcctggccttcggcacgctgctctgcatt
ggcatcatcctgaggttcaagaagacgtggaagctgcaggctctgagagaaggcaagacg
aacatgcacccgccgtattctctgggacagctggtctctgagaggcccaagcccacccca
gtgctggttcccctcatctccccgccagtgtcccccagcagccttgggtctgacaacatc
tcgaggcacagccggccagatgccaggggccctcagagcccttatgatatcagcaatagg
gactacttcttccccagatag

KEGG   Manis javanica (Malayan pangolin): 108394461
Entry
108394461         CDS       T06054                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108394461 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108394461 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108394461 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108394461 (IL13RA1)
   04090 CD molecules [BR:mjv04090]
    108394461 (IL13RA1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108394461 (IL13RA1)
CD molecules [BR:mjv04090]
 Proteins
  108394461 (IL13RA1)
SSDB
Motif
Pfam: LIFR_D2 fn3
Other DBs
NCBI-GeneID: 108394461
NCBI-ProteinID: XP_017511527
LinkDB
Position
Unknown
AA seq 227 aa
MVKDNAGKIRPSFHIVPLSSHVKPDPPHIKKLFFHNGDLYVQWKNPQNFYSRCLSYQVEV
NNSQTKTHDIFYVEEAKCQNSEFEGNLEFISKGTICFMVPGVLPDTLNTVRIRVKTNKLC
YEDDKFWSNWSQEMSIGKKDNPALYITMLLTIPVILAVAVMILLLYLKRLKIIIFPPIPD
PGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENLKRASQ
NT seq 684 nt   +upstreamnt  +downstreamnt
atggtcaaggataatgcaggaaaaatcagaccatccttccatatagtgcctttatcttct
catgtgaaacctgatcctccacatattaaaaagctcttcttccacaatggtgacttatat
gtgcaatggaagaatccacagaatttttatagcagatgcttatcttatcaagtagaagtc
aataacagccaaaccaagactcatgatattttctacgttgaagaagccaaatgtcagaat
tcggaatttgagggaaacctggagtttatatctaagggtacaatttgtttcatggtcccc
ggcgttcttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgc
tatgaggatgacaaattctggagtaattggagtcaagagatgagtataggtaaaaaggac
aatcccgctctctacatcaccatgttactcaccattccagtcatcttagcagttgcagtc
atgatccttctactttatctgaaaaggctcaagatcattatattccctccaattcctgat
cctggcaagatatttaaagaaatgtttggagaccagaatgatgataccttgcactggaag
aagtatgacatctatgagaagcaaaccaaggaagaaactgactctgtagtgctgatagaa
aacctgaagagagcctctcagtga

KEGG   Manis javanica (Malayan pangolin): 108395488
Entry
108395488         CDS       T06054                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108395488 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108395488 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108395488 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mjv00537]
    108395488 (CNTFR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108395488 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mjv00537]
 Receptors
  108395488 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 108395488
NCBI-ProteinID: XP_017513315
LinkDB
Position
Unknown
AA seq 371 aa
MAAPVPWACCAVLAATAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNG
TDLTPDLLNGSQLVLRGLELGRSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTY
PKGFYCTWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSI
SVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLK
FFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATP
WTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSALLFISVPVIVALA
AAATTASSLLI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggccgctcctgttccgtgggcctgctgtgccgtgctggctgccaccgctgttgtctac
gcccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctgggctcagat
gtgactctgccatgtgggacagcaaactgggatgcagctgtgacgtggcgagtaaacggg
acagacctgacccctgatctgctcaatggctctcagctcgtgctccggggcctggaactg
ggccgcagtggcctgtatgcctgcttccaccgtgactcctggcacctgcgtcaccaggtc
ctcctgcatgtgggcttgccgccacgggagcctgtgctcagctgccgctccaacacctac
cccaaaggcttctactgcacctggcatctgcccacccccacgtacatccccaacaccttc
aacgtgaccgtgctgcacggctccaaaattatggtctgtgagaaggacccagccctcaag
aaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcaata
agtgtcagcaatgccctgggccacaacgccacagctatcacctttgacgagttcaccatt
gtgaagcctgaccctccagaaaacgtggtagcccggccagtgcccagcaaccctcgccgg
ctagaggtgacatggcagaccccttcaacctggcctgaccctgagtcctttcctctcaag
ttcttcctgcgctatcgacccctcatcctggaccagtggcagcatgtggagctgtctgat
ggcacagcacacaccatcacggatgcctacgctgggaaggaatatatcatccaggtggcg
gccaaagacaatgagatcgggacgtggagtgactggagtgtggctgctcatgccacgccc
tggactgaggagccacgacacctcaccactgaagcccaggcccctgagaccacgaccagc
actaccagctcactggcgcccccgcccaccacgaagatctgtgaccctggggagctgggc
agcggtggaggaccctcggcactcttatttatcagtgtccctgtcattgtggccctggct
gccgctgccaccaccgccagcagtctcctgatctga

KEGG   Manis javanica (Malayan pangolin): 108395551
Entry
108395551         CDS       T06054                                 

Gene name
GALT
Definition
(RefSeq) galactose-1-phosphate uridylyltransferase isoform X1
  KO
K05056  interleukin 11 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108395551 (GALT)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108395551 (GALT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108395551 (GALT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108395551 (GALT)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108395551 (GALT)
SSDB
Motif
Pfam: GalP_UDP_transf GalP_UDP_tr_C ig Ig_3 Ig_2 HIT EpoR_lig-bind
Other DBs
NCBI-GeneID: 108395551
NCBI-ProteinID: XP_017513420
LinkDB
Position
Unknown
AA seq 756 aa
MATAFRASEHQHIRYNPLHDEWVLVSAHRMKRPWQGQVEPPLLKIVPRHDPHNPLCPGAT
RANGEVNPLYDGTFLFDNDFPALQPDAPNPGPSDHPLFQAEAARGVCKVMCFHPWSDVTL
PLMSVPEIRAVIDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIA
QREERTQRAYHSKNGEPLLMEYGRQELLRKERLVLTSEHWLVLVPFWAVWPFQTLLLPRR
HVRRLPELSPAERDDLASVMKKLLIKYDNLFETSFPYSMGWHGAPTGSEARADWDHWQLH
AHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQMSSSCSGLSRVLVAMATALVSASSPC
LQTWGPPGVQYGQPGSSMTLCCPGVTIGAPVSWFRDGETRLLQGPDSGLGHELVLARVGS
TDEGTYICRTLDGALGGMVTLQLGYPPTRPVVSCQAADYENFSCTWSPSQGSGLPTRYLT
SYRKKTVPGADVQRMSSSTGPWPCPQDPPGAARCVVHGAEFWSQYRINVTEVNPLGASTR
LLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPTSWPRQPHFLLKFRLQYRPVQHP
VWSMVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSVWSPEAWGTPSTGSLWKEIPA
GGQPHSQPEEGHQGGSSAPPKPSLLPDPQPLDHRDPLEQVAVLASLGIFSFLGLVAGALA
LGLWLRLRLDRKDGPQKLGFLTTMIPVDKLSGSPNL
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggccacagccttccgagcgagcgagcatcagcatatccgctacaacccgctacatgat
gagtgggtgctggtgtcagctcaccgcatgaagcggccctggcaggggcaggtagagccc
ccgcttctgaagatagtgccccgccatgatccccacaaccctctgtgtcctggagccaca
cgggccaatggagaggtgaatcccctctacgacggcactttcctgtttgacaatgacttc
cctgctctgcagcctgatgcccccaatccaggacccagtgatcatccccttttccaagca
gaggctgctcgaggagtttgtaaggtcatgtgcttccacccgtggtcggatgtgacgctg
ccactcatgtcagtccctgagattcgcgctgtcatcgatgcgtgggcctcagtcacagag
gagctgggtgcccagtacccttgggtgcagatctttgaaaacaaaggagccatgatgggc
tgttccaacccccacccccactgccaggtgtgggccagcagtttcctgccagatattgcc
cagcgtgaggaaagaactcagcgggcctatcacagtaaaaatggagagcccttgctgatg
gagtatggccgccaggagctgctcaggaaggaacgtctggtcctaaccagtgagcactgg
ttagtgctggtccccttctgggcagtgtggcccttccagacactgctgctgccccgtcgg
catgtgcggcggctgcccgagctgagccctgctgagcgtgatgatctagcctccgtcatg
aagaagctcttgatcaagtatgacaacttatttgagacatcctttccctactccatgggc
tggcacggggctcccacgggatcagaagccagagctgactgggaccactggcagctgcat
gctcattactaccctccactcctgcgctctgccactgtccggaaattcatggttggctac
gaaatgcttgcccaggctcagagggacctcacccctgagcagatgagcagcagctgctca
gggctgagcagggtcctggtggccatggctacagccctggtatctgcttcctctccctgc
ctccagacctggggacccccaggggtccagtatgggcagcctggcagctccatgacactg
tgttgccctggagtgaccattggggccccagtgtcctggtttcgggacggggagacaagg
ctgctccagggacctgactctggactagggcacgaactggtcctggcccgggtaggcagt
actgatgagggcacctacatctgccggaccctggacggtgcacttgggggcatggtgacc
ctgcagctgggctatcccccaactcgccctgttgtctcctgccaagcagctgactatgag
aacttctcctgcacttggagtcccagccagggcagcggtttacccacccgctacctcacc
tcctacaggaagaagacagtgccaggagctgatgtccagaggatgagttcatccacaggg
ccctggccatgcccacaggaccccccaggggctgcccgctgtgtagtccatggggcagag
ttctggagccagtaccggatcaatgtgactgaggtgaaccctctgggggccagcacacgc
ctgctggatgtcagcttgcagagcatcttgcgccctgacccaccccaggggttgcgggta
gagtcggtacctggctatccgcgccgtctgcgtgccagctggacataccccacctcctgg
ccccgccagccccacttcttgctcaagttccggctgcagtaccgtccagtgcagcatcca
gtatggtccatggtggagccggcaggattggaggaggtgatcacagacgccgtggctggg
ctgccccatgccgtgcgggtcagtgcccgggactttctggacgctggcacttggagtgtc
tggagccctgaggcttgggggactccaagcactgggtccctatggaaggagataccagct
gggggccagccacactctcagccagaggaggggcatcaggggggcagctccgctccccca
aagccctctctcctgccagacccacagccacttgaccacagagaccccctggagcaggtg
gcagtgctggcctctctgggaattttctctttcctgggactagtggctggagccctggca
ctggggctctggctgaggctgagactggacaggaaggatggaccccaaaagcttgggttc
ttgaccacaatgattccagtggacaaactttcaggatctccaaacctgtag

KEGG   Manis javanica (Malayan pangolin): 108396596
Entry
108396596         CDS       T06054                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396596 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    108396596 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108396596 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108396596 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108396596 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    108396596 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    108396596 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108396596 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108396596 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108396596 (IFNAR1)
   05160 Hepatitis C
    108396596 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    108396596 (IFNAR1)
   05164 Influenza A
    108396596 (IFNAR1)
   05162 Measles
    108396596 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    108396596 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108396596 (IFNAR1)
   05169 Epstein-Barr virus infection
    108396596 (IFNAR1)
   05165 Human papillomavirus infection
    108396596 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108396596 (IFNAR1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IFN receptor family
   108396596 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 108396596
NCBI-ProteinID: XP_017515013
LinkDB
Position
Unknown
AA seq 433 aa
MLALLGAATLGLLAGALRVSPAAAGRTNLKSPHNVEVYIVDDNFILKWNRSNEAVGNVTF
SADYLIPRMDNWMKLPGCQYVTSTKCNFSSLKLNVYEKIKLRIRAEKGNNTSPWYELNSF
IPFQKAHIGPPKVHLEAEDKAIIINISPPGTHGSNMWAMDNSSFTYSLVIWKNSSSTEER
TETVYPRDKIYKLSPETTYCLKVKARLWRKVGLYSPVYCISTTVENKLPAPENIHISAKD
QVYILNWDYTNENVTFQAQWLYAYLKKIPGNHLDKWKQIPDCENVKTTQCVFPQNVFPKG
IYFIRVQASNGNNTSLWSEEKRFYGETQTIIFPPVLNLKSINDDSLRVYIGVPKNSDNKS
VNQPYPLIYEITFWENISNAESKILKKKTDFTFPNLKPLTVYCVKARALIEDDKWNKSSV
FSDTVCEKTKSGQ
NT seq 1301 nt   +upstreamnt  +downstreamnt
atgctcgccctgctgggcgcggcgaccctggggctcctggctggcgctctgcgggtgtcg
ccggcagccgcagggagaacaaatctaaagtctcctcataatgtagaggtctacatcgtt
gatgacaactttatcctcaagtggaacaggagcaatgaggctgttgggaacgtgactttt
tcagcagattatctaatacccaggatggataattggatgaaattgcctggatgtcaatat
gttactagtaccaaatgcaacttttcttcactcaaactaaatgtttatgaaaaaatcaaa
ttgcgcataagagcagaaaaaggaaacaacacttctccgtggtatgagcttaactcattt
ataccatttcaaaaagctcacattggtcctccaaaagtacacttagaagccgaagataag
gcaataataataaacatctctcctcctgggacacatggtagcaacatgtgggctatggat
aattcaagctttacatatagcttagttatctggaaaaattcttcaagtacagaagaaagg
actgaaacagtttatcccagagataaaatttataaactctcaccagagactacctattgt
ttaaaagttaaagcaagactgtggagaaaagttggtctctatagcccagtgtattgtata
agtaccacagttgaaaataaactgcctgcaccagaaaatatacacatcagtgctaaggat
caggtttacattcttaactgggattacacgaacgaaaacgtgacttttcaagctcagtgg
ctgtatgcctatttgaaaaagattcctgggaaccatttagataagtggaaacaaatacca
gattgtgagaacgtcaaaactacccagtgtgtctttcctcaaaatgttttcccaaaagga
atttactttatccgcgtacaagcatctaatggaaataacacatctctttggtctgaagag
aaaagattttatggagaaacacaaactatcatattccctccagtccttaacttgaagtcc
attaatgatgactcactgcgtgtctatattggtgtcccaaagaattctgacaacaagtct
gtgaaccagccctatccactgatttatgaaattactttttgggaaaacatttcaaatgct
gagagcaaaattctaaagaaaaaaacggactttacttttcctaacttgaaacctctaact
gtatattgtgtcaaagccagagccctcattgaggatgacaagtggaataaaagcagtgtt
tttagtgacactgtgtgtgagaaaacaaaatcaggtcagaa

KEGG   Manis javanica (Malayan pangolin): 108398989
Entry
108398989         CDS       T06054                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108398989 (EPOR)
   04151 PI3K-Akt signaling pathway
    108398989 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398989 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108398989 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398989 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108398989 (EPOR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108398989 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 108398989
NCBI-ProteinID: XP_017518949
LinkDB
Position
Unknown
AA seq 509 aa
MDHLGAPLWPGVGSVCLLLAGAAWATQPNFPDPNFESKAALLAARRPEELLCFTERLEDL
VCFWEEAAGAGVGPENYSFSYQLEGEPRKPCRLRRAPTARGTVRFWCSLPTADTSSFVPL
ELLVSAAPSGAPLYRRTIHINEVVLLDPPAGLLARRADEGGQVVLRWLPPPGAPMASLIR
YEVNISAHNAAGGAQRVEILDGRTECVLSNLRGGTRYTFLVRARMAEPSFGGFWSAWSEP
ASLLTASDLDPLILTLSLILVLILLLLAVLALLSHRRALKQKIWPGIPGPESEFEGLFTT
HKGNFQLWLYQNDGCLWWSHCTPFAEDPPAALEVLSERCWGVTQVVEPGADDEGPLLEPV
GSEHVQDTYLVLDKWLLPRSPPSEALPQPGGSLDMAAMDKGSEASSCSSSLAQKPGPEGA
SATSFEYTILDASSQLLRPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQRG
SSNGHHSNPYENSLLPAPEPSPSSYVACS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggatcatctcggggcacccctctggcctggagtcggctccgtctgtctcctgctcgct
ggggctgcctgggctactcagcccaacttcccggaccccaattttgaaagtaaagcggcc
ctgctggcggcccgccggcctgaagagcttctgtgtttcacggagcggttggaggacttg
gtgtgtttctgggaggaagcagcaggcgcaggggtcggccccgagaactacagcttctcc
taccagctggagggtgagccaaggaagccgtgccgcttgcgccgggcgcccacggcccgt
ggcacggtgcgtttctggtgttcgttgcctacggccgacacgtcgagcttcgtgccctta
gagctgctggtttcagctgccccctccggcgctccactctaccgccgcaccatacacata
aacgaagtggtgctcctggatccccccgcgggactgctggccaggcgggcggatgagggc
ggccaagtggtactgcgctggctcccgccgcctggggccccgatggcaagccttatccgc
tacgaggtgaacatctccgcgcataacgccgcaggtggagcgcagagggtggagatcctg
gatggccgcactgagtgcgtgctgagcaacctgcggggaggaacgcgctacactttcttg
gtacgcgcgcgcatggccgaacccagcttcggcggcttctggagcgcctggtccgagcct
gcgtcgctgctgacagcaagcgacttggaccccctcatcctgacgctctccctcatcctg
gtgctcatcctgctgctgctggctgtgctcgccctgctctcccatcgccgggccctgaag
cagaagatctggcctggcatcccaggccctgagagtgagtttgagggcctcttcaccacc
cacaagggaaacttccagctgtggctgtaccagaacgacggctgtctgtggtggagccac
tgtaccccctttgcagaggacccacctgcagccctggaagtcctctctgaacgctgctgg
ggggtgacacaggtggtggagccaggggcagatgatgaggggcctctgctggagccggtg
ggtagtgagcatgtccaggacacctacctggtgctggacaagtggttgctgccccggagc
ccacccagcgaggccctcccacagcctggtggcagtttggacatggcagccatggacaaa
ggctcagaagcatcctcttgttcatcctctttggcccaaaagcctgggccagagggggcc
tcagctaccagctttgagtataccatcctagatgccagctcccagctcctgcgcccaagg
gcactgccccctgaactaccccccaccccaccccacctgaaatatttgtaccttgtggtg
tctgactctggcatctcaactgattacagctcaggagactcccagggagcccagagaggg
tcatccaatggccaccactccaacccttatgagaatagcctcctcccagcccccgaacct
tccccctccagctatgtggcttgctcatag

KEGG   Manis javanica (Malayan pangolin): 108399808
Entry
108399808         CDS       T06054                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108399808 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108399808 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108399808 (IL13RA2)
   04090 CD molecules [BR:mjv04090]
    108399808 (IL13RA2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108399808 (IL13RA2)
CD molecules [BR:mjv04090]
 Proteins
  108399808 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 108399808
NCBI-ProteinID: XP_017520294
LinkDB
Position
Unknown
AA seq 387 aa
MAFNHLDTRCLYILLLCTAFGSTLSSNAEIKVNPPQEFEIVDPGYLGYLCLQWQPPLSLD
NFKECTVEYVLKYRNIGNENWKTIITRNLHYKDGFDLNKGVEAKIHTLLPVQCTNGSEVQ
SAWSEAIYWISPQGNLETKIQDMDCVYYNWQYLFCSWKPGMDVHFDTNYNLFYWYEGLEH
ALQCADYVMVNGKNIGCRFPYLKSSDYKDFYICVNGSSESQSIRSSYFIFQLQNKVKPLP
PNFLSLTVKNSEEINLRWSMSEGPIPANCLIYEIEFTEDDTTWVTTAVENEVYITRTANE
SQQLCFLVRSKVNIYCADDGIWSEWSDKQCWKGEILKETLVFLLMPFACISLFILLVTCL
LLYKQKAFKKMIFHTKKEVFSHQETHC
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggctttcaatcatttggataccagatgcctatatattcttcttctttgcacagcattt
ggctctactttgtcttcaaatgctgagataaaagttaatcctcctcaggaatttgagata
gtggatcctggatatttaggttatctctgtttgcaatggcaacctccactgtctttggat
aattttaaggaatgcacagtagaatatgtattaaaatatcgaaacattggtaatgaaaac
tggaagaccatcattactaggaatctacattacaaagatgggtttgaccttaacaaaggc
gttgaagcaaagatacacacacttttgccagtgcagtgcacaaacggatcagaagttcaa
agtgcatggtcagaagctatttactggatatcaccacaaggaaatctggaaactaaaatt
caggatatggattgtgtatattacaactggcaatatttattctgttcttggaaacctggc
atggatgtccattttgataccaattacaacttgttttactggtatgagggcttggaacat
gcattacagtgtgctgattatgtcatggttaatggaaaaaatattggctgcaggtttccc
tatttgaagtcatcagactataaagatttctacatctgtgttaatggatcatcagaatcg
cagtctatcagatccagctatttcatttttcagcttcaaaataaagttaaacctttgcca
ccaaacttccttagtcttactgtgaagaactcagaggaaattaacctaagatggagcatg
tctgagggacccattccagcaaactgtttgatttatgaaattgagttcacagaagatgat
actacctgggtgactaccgcagttgaaaatgaggtatacatcacaagaacagcaaatgaa
agccagcaattatgctttttagtaagaagcaaagtgaatatttattgcgcagatgatgga
atttggagtgagtggagtgataaacaatgttggaaaggtgaaatactgaaggaaaccttg
gtatttttattgatgccatttgcttgtatctcattatttattctgttagtaacttgtctg
cttttgtataagcaaaaagcttttaagaaaatgatttttcatacaaaaaaagaagtcttt
tctcatcaagagacacactgctga

KEGG   Manis javanica (Malayan pangolin): 108400493
Entry
108400493         CDS       T06054                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400493 (GHR)
   04151 PI3K-Akt signaling pathway
    108400493 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108400493 (GHR)
   04060 Cytokine-cytokine receptor interaction
    108400493 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108400493 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108400493 (GHR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108400493 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 108400493
NCBI-ProteinID: XP_017521375
LinkDB
Position
Unknown
AA seq 637 aa
MDLWQLLLTLAVAGSSDAFPGTEATAGTLGRASQSLQRVNPGIGTNSSGKPKFTKCRSPE
LETFSCHWTDGVHHGLKSPGSIQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTS
IWIPYCIKLTSNGDTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPN
ADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKDYEVRVRSRQRNSEKY
GEFSEVLYVTLPQMSPFACEEDFQFPWFLIIIFGIFGLTMIVFLFIFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDDPDDKTEGS
DTDRLLRNDHQKSLNILGAKDDDSGRTSCCEPDILETDFNASDICDGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPSSDITPAPQQPSVTLAEENKPRALLSDAESTHQAAHPQLSNPSSL
ANIDFYAQVSDITPAGSVVLSPGQKNKAGISQCDIHPEGVSLCPASVIMDNAYFCEADAK
KCIAVAPHVEVESQVQPSFNQEDIYITTESLTTTAGRSGTAEGAPSSEMPVPDYTSIHIV
QSPQGLILNATAWPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggatctctggcaactgctgttgaccttggcagtggcaggctcaagcgatgcttttcct
gggactgaagccacagcaggtacccttggcagagcatcccagagtctgcaaagagttaat
ccaggcataggaacaaattcttctggaaagccaaaattcaccaagtgccgttcacctgaa
ctagaaactttttcatgccactggacagatggggttcatcacggtttaaagagcccagga
tccatacagctgttctatattagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattacgtctctgctggagaaaacagctgttactttaattcatcttatacctcc
atttggatcccctactgtatcaagctaactagcaatggtgatacagtggatcaaaagtgt
ttctctgttgaggaaatagttcaaccagatccacccattggcctcaactggactttactg
aacatcagtttaacggggattcatgcagatatccaagtgagatgggaaccaccgcccaat
gcagatgttcagaaggggtggatagttctagagtatgaattgcaatacaaagaagtaaat
gagacccaatggaaaatgatggaccctgtattgtcaacatcagttcctgtgtactcactg
agactggataaagactatgaagtgcgtgtgagatccagacaacgaaactctgaaaaatac
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagcccatttgcatgtgaa
gaagatttccagtttccatggttcttaattatcatctttggaatatttgggctaacaatg
atagtatttttattcatattttcaaaacaacaaaggattaagatgctgattctgccccca
gttccagttccaaagattaaaggaattgatccagatctcctcaaggaaggaaaattagaa
gaggtgaacacaatcttagccattcatgacaattataagcctgaattctacaatgatgac
tcgtgggtagaattcattgagctggatattgatgaccctgatgacaagactgaaggatca
gacacagacagacttctacgcaatgaccaccagaaatcacttaatatccttggggcaaag
gatgacgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccagtgacatttgtgatggtacctcagaggttgctcagccacaaaggttaaaaggggaa
gcagatctcttgtgccttgaccagaaaaatcaaaataactcaccttctagtgatattact
cctgctccccagcagcccagtgttaccctagcagaagaaaacaaaccaagagcacttctt
agtgacgctgagtcaactcatcaagctgcccatcctcagctaagcaatccgagttcactg
gcaaacattgacttttacgcccaggtaagcgacattacaccagcagggagtgtggtcctg
tccccaggccaaaagaacaaggcagggatatcccagtgtgacatacatccagaaggggtc
tcgctctgcccagccagcgttatcatggacaacgcctacttctgcgaggcagatgccaaa
aagtgcatcgccgtggcccctcacgtcgaggttgaatcacaagtgcagccaagctttaac
caagaagacatttacatcaccacagaaagccttaccactactgctgggaggtctgggaca
gcagaaggagctccaagttcagagatgcctgtcccagactatacctcaattcatatagta
cagtctccacagggcctcatactcaatgcgaccgcctggcccttgcctgacaaagagttt
ctctcatcgtgtggctatgtgagcacagaccaactgaacaaaatcatgccatag

KEGG   Manis javanica (Malayan pangolin): 108400801
Entry
108400801         CDS       T06054                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400801 (CSF3R)
   04151 PI3K-Akt signaling pathway
    108400801 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108400801 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108400801 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400801 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108400801 (CSF3R)
   04090 CD molecules [BR:mjv04090]
    108400801 (CSF3R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108400801 (CSF3R)
CD molecules [BR:mjv04090]
 Proteins
  108400801 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig fn3_2 Tissue_fac
Other DBs
NCBI-GeneID: 108400801
NCBI-ProteinID: XP_017521870
LinkDB
Position
Unknown
AA seq 835 aa
MAGLGTWSLTGAALIILLLPRSLEECGHISLSASIVRLGDPITASCIINQNCSHLGPDSQ
ILWKLGAELQPGGRQQHLADGTQKSTITLPHVNHTWDTLSCCVRWGNSLQILDQAELQAG
NPPAKPHNLSCLMNLTTNSLICQWEPGPDSHLSTNFTLKSFKSRDKCQTEEDSILDCVPA
EAQSRCSIPRKHLQLYQSMSIWVQAENALGTSRSPQLCLDPMDVVKLEPPTLWALASPHP
HCLQLSWKMWKSSLYIEQKCELRHQPQLGEASWALVDSLPSNTFQHELCGLLPSTAYVLQ
MRCIRWPLPGHWSDWSPRLELTTAQQAPIVRLDTWWQQRQLDTRTVDVQLFWKPVPLVED
SGQIQGYLVFWKPSGQDGAARQLPLCNTTELNCTFHLPSEAQEVDLVAYNTAGTSHPTPV
VFLDSRGPPLVRLYTMARDPHSVWVGWEPPNPQPHAYVIEWGLGPPSPSGSNKNWRMEHN
GSISGTLLEDNIRPFQLYEITVTPLYQDTMGPSQHIYAYSQEMAPSQTPELHLRHIGKTW
AQLEWVPQAPELGKSPFTHYTIFWTNAQDQSFSTVLNASSHGWVLHGLEPGSLYHVHLMA
TSQAGAINSTSLTLMTLALEESEMHILLGLFGLLLSVICLCGAAKFCCRPSRKNPLWPSV
PDPAHSSLGSWVPTITVEETFQLPSLRDPGMPPITKITVLEEEEKKPGPWESNDSSGTCG
LPTLVQAYVLQGDPRAPSTQPQPQSGTSDQVFYGQVLGSPTSPGHYLRCDSTQPLLGGFT
PSPKSYENLWFQTSPLETPDPLLPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGF
NT seq 2508 nt   +upstreamnt  +downstreamnt
atggcgggcctggggacctggagcctgactggagctgccctcatcatcctgctgctcccc
agaagcctggaggagtgtgggcacatcagcctttcagcctccatcgtccgcttaggagat
cccatcacagcctcctgcatcatcaaccagaattgtagccacctgggcccggactcacag
attctttggaaattgggagcagagcttcaaccagggggcaggcagcagcacctggcagat
gggacccagaaatccaccatcaccctgcctcatgtcaaccacacttgggacactctctcc
tgctgcgtgcgctggggcaacagcctgcagatcctggaccaggctgagctgcaggcaggc
aaccctcctgccaaaccccacaacctgtcctgcctcatgaacctcacaacaaacagcctc
atctgccagtgggaaccaggacctgacagccacctgtccaccaacttcaccctaaagagt
ttcaagagccgggacaaatgccagactgaagaggactccatcctggactgcgtgcctgcg
gaggcacagagccgctgctccatcccacgtaaacacctgcagctgtaccagagtatgagc
atctgggtgcaggcagagaatgcactggggaccagcaggtccccacagctgtgccttgat
cccatggatgttgtcaaactggagcccccaacactgtgggccctggcctcaccccaccca
cactgcctgcagttgagctggaagatgtggaagtcaagcctgtacatagaacagaagtgt
gagctgcgccaccagccacagcttggagaagccagctgggccctggtggactccctgccc
tccaacaccttccagcatgagctctgcgggctcctcccatccacagcctacgtcctgcag
atgcgctgcatccgctggcccctgcctggccactggagtgactggagccccaggctggag
ctgaccaccgcacaacaggcccccattgtcagactggacacctggtggcagcagaggcag
ctggacaccaggacagtggacgtgcagctattctggaagccagtgcctctggtggaagac
agtgggcaaatccaagggtacctggtcttctggaaaccctcaggccaggatggagcagcc
agacagctacctctctgcaacaccacagagctaaactgcaccttccacttgccttcagaa
gcccaggaggtggaccttgtggcctataatacagctgggacctctcatcccaccccagtg
gtcttcttggatagcagaggcccacccctggtcagactctacaccatggcccgagatcct
cacagtgtctgggtaggctgggagccccccaaccctcagcctcacgcctatgtgatcgag
tggggcctaggtcctcccagtcccagcggcagcaataaaaactggagaatggagcataat
gggagcatttcagggaccctgctggaggacaacatcaggcccttccagctctatgagatc
actgtgacacccctgtaccaggacaccatgggaccctcccagcacatctatgcctactcc
caagagatggccccctctcagaccccagagctgcacctaaggcacattggcaagacctgg
gcccagctggagtgggtgccccaggcccctgagctggggaagagcccctttacccactac
accatcttctggaccaatgctcaggaccagtccttctccactgtcctaaatgcctcctcc
catggctgggtcctccatggcctggagcctggcagcttgtaccacgtccacctcatggct
accagccaggcaggggccatcaacagtacaagcctcaccctgatgaccttggcgctagag
gagtcagagatgcacatcctcctaggcctgtttggcctcctgctctcagtcatttgcctc
tgtggggctgccaagttctgctgcagacccagcagaaagaatcccctctggccaagtgtc
ccagacccagcccacagcagcctgggctcctgggtgcctaccatcacggtggaggagacc
ttccagctgcccagccttcgggaccccggcatgccacccatcaccaagatcacagtgctg
gaggaagaagagaagaagccagggccctgggagtccaatgacagctccgggacctgtggc
ctccccaccctggtccaggcctatgtgctccagggggacccaagagcaccttccacccag
ccccaaccccagtctggcaccagcgaccaggtcttttatggccaggttctgggcagcccc
acaagcccagggcactacctccgctgtgactcaactcagcccctcttggggggcttcact
ccaagtcccaagtcctatgagaacctctggttccagaccagccccctggagaccccagat
cccctactcccaaaccaggaggatgattgcgtctttgggccactgcttgacttccccctc
ctgcaggggctccaggtccatggggtggaggggctgggaggcttctag

KEGG   Manis javanica (Malayan pangolin): 108401571
Entry
108401571         CDS       T06054                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108401571 (OSMR)
   04151 PI3K-Akt signaling pathway
    108401571 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108401571 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108401571 (OSMR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108401571 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 108401571
NCBI-ProteinID: XP_017523067
LinkDB
Position
Unknown
AA seq 993 aa
MAASRVGTFGGGILGKPEPMALLVVLQTTFLLALLSLRTYQSEVLSEPLPVTPDSLTVSV
NSTHQRLHLQWNVHNLPYQELKMIFQIEISRINTSNVIWVENYSTTVRWNHALHWSWESE
LPVECATHFVRIRGVVDDAKIPRPRFWSHWSSWEEVDVRSSLGEDPLSVFPKDKLVEEGS
NVTICYVSRSHQKNISCFLDGVQIHGDQLDPNVCAFTLNNVPFVRETGTNFYCEMNQGEI
PEGIVLFVSKVLEEPKDFSCETQDFRALNCTWDPGSDTGLTKHPSQSYTLFESFSGKKTL
CKHKNWCDWQVIQHSQEMYNFTLVAENYLRKRSVSTVFNLTHQVRPMNPFNVSFKNVHAT
EATVMWKAHSIGNNFILLCQVELNSEGKVIQQHNVSIKVNGEYLLSELKPDTKYVTRVRC
ANANHFWKWSEWTGQNLITSEAAPSEAPDVWRKVKSVPGCHMVTLFWKPLPKWHANGKIL
FYNVVIENLGEPSKSKLLSIPAPANGTELTLDEGSYQIHITANNSVGTSPASVIVIPGDL
GNKEVEEERVKGTEDGFSLSWKPQSGDVLDYLVEWCDHPWDPLCDLQWENLGPNTTSTMI
SSDAFRPGVRYNFRVYGISTKRIAYLLEKKTGYSQELAPSVSPQAVMSNLTSHSVTLSWK
DYATESEPGFIRGYYVYMKSKAKQCHPGFEKAVLSDDSVCCKYVISDPEQKTLVMENLQP
ESSYEFLVTPYTSVGTGPHGAFTKVTTPGEYSYTLMRFLLPLIFCILFITVVCYLKSQWM
KENCYPDIPDPYKSSVLSLIKSKENPHLTIMKVNDCIPDAIEVVNKPEGNKMQFLGTRKS
LTETELTKPACFYLLPTENYLGPGPHICFENFTYNQAASESDCCGRVTVSPTAPPSQLGL
LTSPENLLKALEKNYMNSLEEIPAGETCLNYVSQLASPMSGNKESLLTNPPLPAVCSEYK
MQMAVPLGLASPPSSESSSVSSITLLDQGEYHG
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggcagcatctcgagttggcactttcggcggcgggatccttggaaaaccagaacctatg
gctctcttggtggtccttcagacaactttcctcttggcattgctgtccttgagaacttac
cagagtgaagtcttgtctgaacctttaccagtgacccctgactccctgactgtttctgtc
aattctacacatcaacgtttgcatttacaatggaatgtccacaaccttccttatcaggaa
ttaaaaatgatttttcagatagagatcagtagaattaacacatccaatgtcatctgggtg
gagaactatagcaccaccgtgaggtggaaccacgctctgcattggagctgggaatctgag
ctccctgtggaatgtgcgacacactttgtaagaataaggggtgtggtggatgatgccaag
atccccaggccaaggttctggagccattggagttcatgggaagaagtggatgtacgaagt
tctcttggagaagatcccttgtctgttttccctaaagataagctggtggaggaaggctcc
aatgtcaccatttgttatgtttctaggagccatcaaaagaacatatcctgttttttggat
ggtgtacagatacacggagaccaacttgacccaaatgtgtgtgcattcaccttgaataac
gtcccttttgttagggaaacagggacaaatttctactgtgagatgaaccaaggagagatt
ccagaaggcatcgttctctttgtctcaaaagtacttgaggagcccaaggacttttcttgt
gaaacacaggacttcagggctttgaactgtacttgggatcccgggagtgacactggctta
actaagcatccttcccaaagctacactttatttgaatcattttctggaaagaagacactt
tgtaaacacaaaaactggtgtgattggcaagtaattcaacattcacaggaaatgtacaac
ttcacactggtggctgaaaactacttaaggaagagaagtgttagcactgtttttaacctg
actcatcaagttcgcccaatgaatccctttaatgtaagttttaaaaatgtacatgccaca
gaggccaccgtgatgtggaaggcacactccattggaaataattttatactgttgtgtcag
gttgaactcaacagtgaaggaaaagtgatacaacaacacaatgtttccatcaaggtgaat
ggtgagtacctcttaagtgaactgaagcctgatacaaagtatgtgactcgggtgcgctgt
gctaatgccaaccacttctggaaatggagtgaatggactggtcaaaacctcatcacctct
gaagctgccccctcagaggctcctgatgtctggagaaaggtgaagtcagtgccaggatgt
catatggtgactttattctggaagccactaccaaaatggcatgccaacgggaagattctg
ttctataatgtagttatagaaaacctaggagaaccatccaagtcaaagcttctctccatt
cctgctccggccaatggcacagaactaacccttgacgagggttcttaccaaatccacatc
acagctaataacagtgtgggcacctctcctgcttcagtaattgttattcctggagacctt
ggaaacaaagaggttgaagaagaaagagttaaaggcacagaggatggattctctctgtcg
tggaaaccccaatccggagatgtcctagactaccttgtggagtggtgtgaccacccctgg
gacccactgtgtgatctccagtgggaaaacctaggtcccaataccaccagtacaatgatt
agctcagatgcttttagaccaggggtccgatacaacttcagagtttatggcatctctaca
aaaaggattgcttatttactagagaaaaaaacaggatactcccaggaactggctccttca
gtcagccctcaagcagtcatgagtaatttgacatcccactccgtcactctgagttggaaa
gattacgccactgaatccgaacctggttttatacgaggttactatgtctatatgaaatcc
aaggcgaagcagtgccacccaggattcgaaaaggcagtactttcagatgattcagtatgt
tgcaaatacgtaatcagtgacccggaacaaaagacacttgtcatggagaacctgcagccg
gaatcctcctatgagtttttggtcactccgtacacaagtgttggcacgggcccccatggt
gctttcacaaaggtcacgactccgggtgaatactcctacacactgatgcggttcctactc
cctctgattttctgcattttgttcatcacagtcgtctgctacttgaaaagccagtggatg
aaagagaactgttatcctgacattccagatccttataagagcagcgtgctatcattaata
aagtccaaggagaatcctcatttaacgataatgaaagtcaacgactgtattccagatgct
attgaagttgttaacaagccggaagggaataagatgcagttcttaggcacaaggaagtca
ctcacagaaactgaacttactaagcctgcctgcttttacctcctccccacagagaactac
ttgggccctggacctcacatctgctttgagaactttacctacaatcaggcagcttctgag
tctgattgttgtggccgtgtcacagtatcccctacagccccaccaagtcagctgggacta
ctgacttcaccagaaaatttactaaaggcactagaaaaaaactatatgaactctctggaa
gaaatcccagctggagaaacctgtttgaattatgtttcccagttggcttcacccatgtct
ggaaacaaggagagtctcctcacaaacccaccactgccagcagtctgttcagagtataaa
atgcaaatggctgtacccctgggtcttgcctcacctccgtcaagtgagagtagcagtgtc
tcctcgatcacccttttagatcaaggtgaataccatggctga

KEGG   Manis javanica (Malayan pangolin): 108402039
Entry
108402039         CDS       T06054                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108402039 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108402039 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108402039 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108402039 (IL9R)
   04090 CD molecules [BR:mjv04090]
    108402039 (IL9R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108402039 (IL9R)
CD molecules [BR:mjv04090]
 Proteins
  108402039 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 108402039
NCBI-ProteinID: XP_017523775
LinkDB
Position
Unknown
AA seq 222 aa
MITAAGDRLAQHKHGPGSKHRCVFQASVCSVLLPPEEVLVPSDSFSITLHHDVSGEEQVS
LVDSQYLPRRHVKLDPPLDLNSNVSSGNCALTWNISPALEPLTSLLSYELAFKKQEETWE
QAWYKDRIFGVTWLILEAVELDPGSSYEARLRVQMATPEDEVAEEERFEGLWSEWSQAVS
FRSPRIRGRLTPALGKPHGTLVPVFIFFLLTSLAFVLFKLSP
NT seq 668 nt   +upstreamnt  +downstreamnt
atgataacagcagcaggggaccggctggcgcaacacaagcacgggccgggcagcaagcac
aggtgtgtcttccaagccagcgtgtgcagtgtgctgcttccccctgaggaggtgctggtg
ccttctgacagcttctccatcactttgcaccatgacgtgtctggggaggagcaggtcagc
ctggtggactcacagtacctgccccggagacatgtgaagctggaccctcctttggacttg
aatagcaatgtcagctctggcaactgtgccctgacctggaacatcagtcctgccttggag
ccactgacctcactcctcagctatgaactggccttcaagaaacaggaagagacttgggag
caggcctggtacaaggatcgcatttttggggtgacctggctcatcctggaagctgttgag
ttggaccctggctccagctatgaggccaggctgcgtgtccagatggccacaccggaggat
gaagtggcagaggaggagcgctttgagggcctgtggagtgagtggagccaggccgtgagc
ttccgctctccccggataagaggccgcctgacccctgctttggggaagccccacggcact
cttgttcctgtcttcatctttttcctgctgaccagtttggcctttgtcctgttcaagctg
tcacccag

KEGG   Manis javanica (Malayan pangolin): 108403309
Entry
108403309         CDS       T06054                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
mjv05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403309 (IL2RG)
   04151 PI3K-Akt signaling pathway
    108403309 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403309 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108403309 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108403309 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108403309 (IL2RG)
   04659 Th17 cell differentiation
    108403309 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108403309 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108403309 (IL2RG)
   05340 Primary immunodeficiency
    108403309 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108403309 (IL2RG)
   05162 Measles
    108403309 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108403309 (IL2RG)
   04090 CD molecules [BR:mjv04090]
    108403309 (IL2RG)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108403309 (IL2RG)
CD molecules [BR:mjv04090]
 Proteins
  108403309 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 108403309
NCBI-ProteinID: XP_017525850
LinkDB
Position
Unknown
AA seq 338 aa
MLKPPLPLRSLLFLQLLLLVVGLNAMLPTPIGNEDITADFFLTSRLPGTLSVPIRPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLYYWYKNSDDDKVRECGHYLFSEEITSGCWLQKE
EIHLYQTFVVQLQDPQEPKRQAIQMLKLQDLVIPWAPENLTLRNLSESQLELSWSNRYLD
HCLEHLVQYRSDWDRSWTEQSVDYRHSFFLPSVDGQKLYTFRVRSRYNPLCGSAQHWSEW
SRPIHWGSTTSKENPSLFALEAVLIPLSSMGLIIGLICVYCWLERAMPRIPTLKSLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPK
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcttctgctggtg
gtggggctgaacgcaatgctccccacgcccattgggaatgaagacatcacagctgatttc
ttccttacctctagactccctgggaccctcagtgttcccatccggcccctcccagaggtc
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagcct
cagcccaccaatttgactctgtactattggtacaagaactcagatgatgataaagttcgg
gagtgtggccactatctattctctgaagagataacttctggctgttggttgcaaaaagag
gagatccatctctaccaaacatttgttgtccagcttcaggacccacaggaacccaagagg
caggccatacagatgctaaaactgcaggatctggtgatcccctgggctccagagaatcta
actcttcgcaacctgagtgaatcccagctagaactgagctggagcaacagatacttggac
cactgtttggagcacctggtgcagtaccggagcgactgggaccgcagctggactgaacaa
tcagtggactataggcatagcttctttctgcctagcgtggatgggcagaaactgtacacg
ttccgggttcggagccgctataacccactctgtgggagtgcccagcattggagtgaatgg
agccgaccaatccactggggcagcactacttcaaaggagaatccttcgttgtttgcattg
gaagctgtgcttatcccccttagctccatgggattgattatcggcctcatctgtgtgtac
tgctggctggaacgggccatgccccgaattcctaccctcaagagcctagaggatctggtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaaaggattggcggagagt
ctgcagccagactacagtgaacggctatgtcacgtcagtgagattcccccaaaatga

KEGG   Manis javanica (Malayan pangolin): 108403518
Entry
108403518         CDS       T06054                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403518 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403518 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108403518 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108403518 (IL27RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108403518 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 108403518
NCBI-ProteinID: XP_017526189
LinkDB
Position
Unknown
AA seq 638 aa
LLLFQRARPHGSPGPLQCYGIAPLGDLNCSWEPLGNLGAPSTLHLQSQKYHSNRTWTVAV
PPRQSWVTIPREQLTTSDELLVWGAEAGQPLWSPVFVNLETRMKPDAPRLCPKVDFPEDD
PLETAIQWEPPVWPPHKILICQFHYRRCQEMAWTLLEPEVTSIPLAPVEIQNLELATGYE
VSGRCRMEKEDLWSEWSPSLSFQTLPSAPKDVWISGNPCGTPGGQEPQQLLWKAPGRCAQ
VAYRVWFHVEGQRLTQDGTPCCNSSIPAQAEWAGVSAVNATSWEPLTNLSLACLGPGSAP
RNVTVSSVAGSMDLLVTWQQGSGALQEYVVDWAQDGDPLENLSWVRLPPGNLSALLPGNF
EGGVPYRVTVTAVSPRGLAPAPPVWSFREELAPLEGPMLWRLQDDPPGTPAVAWGEVPRH
QLRGHLTHYTLCAQSGTRPSVCLNVSGSTQNITLPNLHWGPCELWVTASTISGEGPPGPS
LQLHLPDNTLKWKVLPGILLLWGLLLMGCGMSLATSRRCLHLRYKVLPRWVWEKVPDPAN
STSSQPHVEEVPQAQPLRDLPILEVEEMEPVLVMKPPEASAQLDSGYEKHFLPTPEELGL
LGPPAPGPRLRPELIAGQESGAHLTDEDLRLNEAESLA
NT seq 1917 nt   +upstreamnt  +downstreamnt
ttactgctgttccaacgggctcggccccacggcagccctgggccactgcagtgctatgga
attgcacccttgggcgacctgaactgctcctgggagcctcttgggaacctgggagccccc
tccacactgcatctccagagccagaagtaccattccaacagaacctggactgtggcagtg
cccccccgccagagctgggtaaccattcctcgagaacagctcaccacatcagatgaactc
cttgtctggggagccgaggcaggccagcctctctggtccccagtcttcgtgaacctggaa
acccgaatgaagccagatgccccccgactctgccccaaggtggactttccagaggatgac
cccttggagactgctatccaatgggagcctcctgtgtggccgccccataagatcctgatc
tgccagttccactaccgaagatgccaggagatggcctggaccctgctagaaccagaagtg
acgtccatacccctggcccctgttgagatccagaatctggaattagccactggctatgag
gtgtctggccgctgccgaatggagaaagaagatttgtggagtgaatggagtcccagcctg
tctttccagaccctgccctctgctccgaaagatgtgtggatatcaggcaacccctgtggg
acaccaggcggtcaggaaccccagcagcttctgtggaaggccccagggcgctgtgcgcag
gtggcctacagagtgtggttccatgtggaaggtcagaggctgacccaggatgggactccc
tgctgcaactcctccatccccgcccaggcggagtgggctggggtgtccgctgtcaatgcc
acaagctgggagcctctcaccaacctgtctttggcctgcttgggtccaggctctgccccg
cgtaacgtgacggtcagcagtgttgctgggagcatggatctgctggtgacttggcaacag
gggtctggggcactgcaggagtacgtggtggattgggctcaagatggggaccccttggag
aacctcagctgggtccggcttcctcctgggaacctcagtgctctgttgccaggaaatttc
gaaggaggggtcccttaccgggtcacagtgacagcagtctctcctcggggcttagcccct
gctcccccagtctggagtttcagagaggaactagcacccctggagggaccgatgctttgg
cgactccaggatgaccccccagggacccccgccgtagcgtggggagaggtccctaggcac
caacttcggggccatctcacgcactacaccttgtgtgcacagagtgggaccagaccgtct
gtctgcttgaatgtgagtggcagcacccagaacatcaccctgcccaaccttcactggggt
ccctgtgagctatgggtgactgcatccaccatctcaggagagggcccacctggtcccagc
ctccagcttcacctaccagataacaccctgaaatggaaagttctgcccggtatccttctc
ctgtggggcttgctcctgatgggatgtggcatgagcctggccacttccagaagatgtctc
cacctgcgatacaaggtgctgccccgctgggtctgggaaaaggttcctgatcctgccaac
agcacttccagccagccccatgtggaggaggtacctcaggcccagcccctcagggactta
cccatccttgaagtggaggagatggagcctgtactggtgatgaagccccccgaggcctcc
gcccagcttgactctgggtatgagaaacacttcctgcccacacctgaggagctgggcctc
ctgggccccccagccccaggccccaggctcaggcctgaactgatcgcaggccaggagagt
ggtgctcatttgacagatgaagacttgaggctcaatgaggctgagtcacttgcctga

KEGG   Manis javanica (Malayan pangolin): 108404133
Entry
108404133         CDS       T06054                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor
  KO
K05058  leukemia inhibitory factor receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108404133 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108404133 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108404133 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108404133 (LIFR)
   04090 CD molecules [BR:mjv04090]
    108404133 (LIFR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108404133 (LIFR)
CD molecules [BR:mjv04090]
 Proteins
  108404133 (LIFR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N IL6Ra-bind DUF3827 TMEM154
Other DBs
NCBI-GeneID: 108404133
NCBI-ProteinID: XP_017527065
LinkDB
Position
Unknown
AA seq 891 aa
MPLECATHYVGIRCYIDDPHFSGHKEWSDWSLLKNISWSPDSRSKVFPQDKVILVGTDIT
FCCVTQEKVLSAQIGQTKCSLIHLDGENVAIKIHNISVSANSGTNVVFTTEDNIFGTVIF
AGYPPDIPQKLNCETYDLKEIICTWNPGRPTALVGPRKTSYTLLESFSGKYVRFQRIEAP
ANESYQLLFQMLPNQEIYNFTLNAHNPLGESESTILVNITEKVYPHIPTSVKVKDINSTA
VTLSWHLPGNFAKVKLLCEIEINTTNSIQELRNVTIRGVENSSYLVAVDKLNPYTIYTFR
IRCATETFWKWSKWSNEKQYLTTEAIPSKGPDTWREWSSDGKNLIIYWKPLPVNEANGKI
LSYNVSCSSDEETQSLSEIPDPQHKAEIQLDKNDYIISVVAKNSVGSSPPSKIASMEIPN
DDLKIEQAIGMGNGILLTWNYDPNMTCDYVIKWCNSSRSEPCLMDWKKVPSNSTETVIES
DQFRPGIRYNFFLYGCRNQGYQLLRSIIGYIEELAPNVAPNFTVEDTSADSILVKWEDIP
VEELRGFLRGYLFYFEKGERDTSKMRDLESGRSDIKVKNITDISQKTLRIADLQGKTSYH
LVLRAYTDGGMGPEKSMFVVTKENSVGLIIAILIPVAVAVIVGVVTSVLCYRKREWIKET
FYPDIPNPENCKALQFQKSVCEGNSPLKTLEMNPCTPNNVEVLETRSTVPKIEDTEIISP
VAERPEDSSDAEPENHVVVSYCPPVIEEEIPNPGVDEAGGASQVIYIDIQSMYQPQAKPE
EEQETDPIEGAGYKPQMHLPITSTVEDLAADDDDDLDKTAGYRPQANVNTWNLVTPDSPR
STDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWSFTNFFQNKPND
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgcccttggagtgtgccactcattatgtgggaattaggtgctacattgatgatcctcat
ttctctggtcacaaagagtggagtgactggagcctactgaagaacatttcttggtctcct
gattctcgttccaaagtttttcctcaagacaaggtgatacttgtaggcacagatataaca
ttttgttgtgtgactcaagaaaaagtgttatcagcacagattggccaaacaaagtgttct
cttatccatcttgatggggaaaatgttgcaatcaagatccataacatttctgtttctgca
aatagtggaacaaatgtggttttcacaacagaagataacatatttggaacagttattttt
gcagggtatccacctgatattcctcaaaaactgaattgtgagacatatgatttaaaagag
attatatgtacttggaatccaggaagaccaacagcactggtgggcccacgcaaaacaagt
tacactttattggaaagtttttcaggaaaatatgtcagatttcaaagaattgaagcacca
gcaaatgaaagctaccagttactctttcagatgcttccaaatcaagaaatatataatttt
actttgaatgctcacaatcctctgggtgaatcagaatcaacgattttagttaacataact
gaaaaagtttacccccatattcctacttcagtcaaagtgaaggatattaattcaacagct
gttacactttcctggcatttaccaggcaattttgcaaaggttaaacttttatgtgagatt
gaaattaatacaactaattcaatacaagaattgcggaatgtcacaatcagaggagtagaa
aattcaagttatcttgttgctgtggacaagttaaatccatatactatatatactttccgg
attcgttgtgctactgaaactttctggaaatggagcaaatggagcaatgaaaaacagtat
ttaaccacagaagccattccttcaaagggaccagatacttggagagagtggagttctgat
ggaaaaaatttaataatctattggaagcctttgcccgttaatgaagctaatggaaaaata
ctttcctataatgtatcatgttcgtcagatgaggaaacacaatccctttctgaaattcct
gatcctcaacacaaggcagaaatacaacttgataaaaatgactatatcatcagtgtggtg
gcaaaaaattctgttggctcatcgccaccttctaaaatagccagtatggagattccaaat
gatgatctcaaaatagagcaggccattggaatgggaaatgggattctcctcacttggaat
tacgatcccaacatgacttgtgactatgttatcaagtggtgtaactcatctcggtctgaa
ccctgccttatggactggaaaaaagtcccttcaaacagcactgagactgtaatagaatct
gatcagttccgaccaggtataagatataattttttcttgtatgggtgcagaaatcaagga
tatcagttattacgttctataattggatatatagaggaattggctccaaatgttgcaccc
aattttactgttgaggatacatctgcagattcaatattagtaaaatgggaagatattcca
gtggaagagctgagaggctttttaagaggatacttattttactttgaaaaaggagagcga
gacacatcgaagatgagagatttagaatcaggtcgttctgacataaaggttaagaatatt
actgatatatcccagaagacactgagaattgctgatcttcaaggtaaaacgagttaccat
ctggtcttgcgagcctatacagatggtggaatgggcccagagaagagcatgtttgtggtc
acaaaggaaaattctgttggattaattattgccattctcatcccagtggcagtggctgtc
attgttggggtggtaacaagtgtcctttgctatcggaagcgagaatggattaaagaaacc
ttctaccctgatattcccaatccagaaaactgtaaagctttacagtttcagaagagtgtc
tgtgagggaaacagtcctcttaaaacattggaaatgaatccctgtaccccaaataatgtt
gaggttctggaaactcgatcaacagttcctaaaatagaagatacagaaataatttctcca
gtggctgagcgtccagaagatagctctgatgcagaacctgaaaaccatgtggttgtgtcc
tattgtccacccgtcattgaggaagaaatcccgaacccgggagtggatgaagccggaggg
gcctcccaagtcatttacatcgatatccagtccatgtatcagcctcaggcaaaaccagag
gaagaacaagaaactgaccccatagagggtgcaggatacaagccacaaatgcaccttccc
attacttctactgtagaagatctcgctgcagatgatgatgatgatttagataaaactgcc
ggttacagacctcaggcaaatgtaaatacttggaacttggtaactccagactcccctaga
tccacagacagcaacagtgaaattgtctcttttggaagtccatgctccattaactcccga
caatttttgattcctcctaaagatgaagactcccctaaatctaatggaggagggtggtcc
tttacaaacttttttcagaacaaaccaaatgactaa

KEGG   Manis javanica (Malayan pangolin): 108404887
Entry
108404887         CDS       T06054                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108404887 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108404887 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108404887 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404887 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108404887 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108404887 (IL23R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108404887 (IL23R)
SSDB
Motif
Pfam: fn3 IL6Ra-bind Lep_receptor_Ig Pur_ac_phosph_N ObR_Ig Interfer-bind PriX
Other DBs
NCBI-GeneID: 108404887
NCBI-ProteinID: XP_017528195
LinkDB
Position
Unknown
AA seq 630 aa
MNQVTIQWDVVIALYIFFNWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAASKNCQ
PRKFYFYKNGIKERLQITRINKTTARLWYNNFVEPHASIYCTAECSGYFQETLICGKDIS
SGYPPDVPDKVTCVIHEYSDTMTCTWNTGKTTYIDTKYVVHVKSLETEEEQQYLTSSYAN
ISTDSLQGGKKYLVWVQAANVLGMEKSKQLQIHLDDIVIPSASIISRAEDINTTVPKTII
HWNSQTTIEKVSCEMRYKATTNQTSWNVKEFDTNFTYMQQSEFYLKPNTEYVFQVRCRET
GKRYWQPWSSSFFHKTSEIVPLVRLKSFQHDTQNSGLLIASIHKGHLISDNQQDIGLLLG
MVSFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLHEDIPNIENSNVVKMLQEKSELL
NNNSSKQVLYVDPVITEVEIFLPEEHKCTDYKKERNTGPLETRDCLQKSLLTSTTVVYIP
DLNTGYKPQISNFLISGNHLGNEETDSLTLKPPIDSLDLGKNTMFKKYPNFAFSVSSMNS
LSNTLFLEELSHILNQGECSPPDMPNSRERETTMPLENTSPKETTPEQTLLPDEFVSCLG
IINEELPSINSYFPQNILESHFSRISLLEK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggatgtggtaatagctctttacatattcttcaactgg
tgtcatggaggaataacaaatataaactgctctggccacatctgggtagaaccagccacc
atttttaagatgggtatgaatatctccatatattgccaagcagcaagtaagaactgccaa
ccaaggaaattttatttttataaaaatggcatcaaagaaagacttcaaattacaagaatt
aataaaacaacagctcggctttggtataacaactttgtagagccacacgcttctatatat
tgcactgctgaatgttctggatattttcaagagacactgatatgtggaaaagacatatct
tctggatatccaccagatgtccctgacaaggtcacctgtgtcattcatgaatattcagac
accatgacttgtacctggaatacagggaagaccacctacatagacacaaagtatgtggtg
catgtgaagagtttagagacagaagaagagcaacaatatctcacttcaagttatgctaac
atctccactgattcattgcaaggtggcaagaaatatttggtttgggtccaagctgcaaac
gtactaggcatggagaagtcaaaacaactgcaaattcacttggatgatatagtgatacct
tctgcatccatcatttccagggctgaggatataaatactacagtgcccaagaccataatt
cactggaacagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaatcaaacttcttggaatgttaaagaatttgacaccaattttacatacatgcaacag
tcagaattctacttgaagccaaacactgagtatgtatttcaagtgaggtgtcgagaaaca
ggtaaaaggtattggcagccctggagttcatccttttttcataaaacatctgaaatagtt
cccctggtcagactgaaatcattccaacatgatactcagaattctgggcttctaattgct
tccatccataaaggacaccttatttctgacaaccaacaagacattggacttttattggga
atggtctcctttgctgttatgctgtcaattctttctttgattgggatatttaacagatcg
ctccgaactggaattaaaagaagaatcttattgctaataccaaagtggcttcatgaagat
attcctaatatagaaaacagcaatgttgtaaaaatgctgcaggaaaaaagtgaacttttg
aataataattccagcaaacaggtcctatatgttgatccagtgattacagaggtagaaatc
tttctcccagaagaacacaagtgcacagactacaaaaaggaaaggaatacaggacccctg
gagacaagagactgcctgcagaagtcactactcaccagtactacagttgtgtatattcct
gatctcaacactgggtataaaccacagatttcaaattttctcattagtggaaaccatctt
ggtaatgaggaaacagattccttaactcttaagccaccaattgattccttagacctagga
aagaatactatgtttaaaaaatatcctaattttgctttttctgtctcaagtatgaattcg
ctaagcaacacattattccttgaagaattaagccacattttaaatcaaggagaatgcagt
cccccagacatgccaaactcaagagagagggaaaccaccatgcctttggaaaatacttca
cccaaagaaactacgccagaacagaccctgctacctgatgaattcgtctcctgtttggga
atcattaatgaggagttgccatctattaattcttattttccacaaaatattttggaaagc
cactttagtagaatttctctcttggaaaagtaa

KEGG   Manis javanica (Malayan pangolin): 108404889
Entry
108404889         CDS       T06054                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108404889 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108404889 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108404889 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404889 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108404889 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108404889 (IL12RB2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL6/12 receptor family
   108404889 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Tissue_fac EpoR_lig-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 108404889
NCBI-ProteinID: XP_017528196
LinkDB
Position
Unknown
AA seq 861 aa
MAHAVRECSFALILLIMLLLVEAKIDVCKRGDVTVKPSHVISLGSTVNISCSLKPKQGCS
QYSSFNRLILYKFDRRINFLHGHFLSSQITGLPLGTTLFVCKLACSNSDEIRVCGAEISV
GVVPEQPQNLSCIQKGERGTMTCTWDRGQDTHLYTAYTLQLNGPNNLTWQKQCNDRYCDH
LDLGINITPESLESSYTAEVTATNSLGSASSFLSTFTFLDIVRPLPPWDIRIRFVNASVS
RCTLQWRDEGLVRLNRLRYRPNNSRSWNTVNATNAKGRHDFLDLKPFTEYEFQISSKLHL
HKGSWSDWSEPLRAQTPEEEPTGMLDVWYTRKHIDYKRQQISLFWKNLSLSEARGKILHY
LVTLQEEAAGKATLQNITEHASWTWVIPRTGNWAVAVEAANSKGNSLPTRINITDLCGAG
LLAPRQVSANSEGMDNILVTWEPPGKAAPAVQEYVVEWRELHSGGSMQPPLNWLRSPPYN
VSALISENINPYICYEISVYALSGHQGGCSSIQGNSEHKAPLSGPNINAILEEKGNILIS
WDEIPAQEQRGCILHYRIYWKERNSSSQPQLCEIPYRVSPNSHPINSLQPKVTYILWMTA
LTAAGESPHGNEREFCLQGKGSWGAFAAPSICTAVIVVGVLFSRCYVRQKVFVLFSALRP
QWCSKEIPDPANSTWAKKYPTVEEKTQLPLDRLLTDWATPEEPETLVINEVLHQVTPIFR
HPHHPNWPEKGRGVQGHYTSEEDIRYNASSPPPPRPLTAETGQLVDLYKVLGNRTPDSKS
GHPASPLVVLPVDYVPTHGGYLPTNTDYLPSREASIADHLEELEPQHISLSVFPSSSLHP
FSCGKKLTLDRLKMGSSSLMP
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacacgcagttagagagtgctcatttgcacttattcttcttatcatgttgctgttg
gttgaagcaaaaatagatgtgtgcaagagaggagatgtaactgtgaagccttcccatgta
atttcacttggatcaactgtgaatatttcatgctctttgaagcccaaacaaggctgttca
cagtattctagttttaacaggttaatcctctacaagtttgacagaagaatcaattttcta
catggtcacttcctcagttctcaaatcacaggacttcccctgggtacaactctgtttgtc
tgcaaattggcctgtagcaatagtgacgagattcgagtatgtggggctgagatctcagtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggagaacgtgggacc
atgacctgcacctgggacagaggacaagacacccacctatatactgcatatactttacag
ttaaatggaccaaacaatttaacttggcagaagcaatgtaatgatcgttactgtgaccat
ttggaccttggaatcaacataacccctgaatcactggaatccagttacacagccgaggtt
actgctaccaatagtcttggaagtgcttcttcatttctatctacattcacatttttggac
atagtgagacctcttcctccatgggacatcagaatcagatttgtaaatgcttctgtgagc
agatgtactcttcagtggagagatgaggggctggtgcggcttaatcgactgagataccgg
cccaacaacagcaggtcctggaatacggttaatgctacaaatgccaaaggaagacatgat
tttctggatctgaagccatttacagaatatgaatttcagatttcctctaagctgcatctt
cataaaggtagttggagtgattggagtgaaccactgagagcacaaacaccagaagaagaa
cccactgggatgttagatgtctggtatacgagaaagcacattgactacaagagacaacag
atttctctcttctggaagaatctgagtttatcagaggcaagaggaaaaatcctccactat
ctggtgaccttgcaagaggaggcagcagggaaagccacactacaaaacatcactgaacat
gcctcctggacatgggtcattcctagaactggaaattgggctgtggctgtggaggcagct
aattcaaagggcaattccctgcccactcgtattaacataacagacctgtgtggggcaggg
ttgttggctcctcgccaggtctctgcaaactctgaggggatggacaacattctggtgaca
tgggaacctcctggaaaagctgccccggctgtccaggagtatgtggtagaatggagagaa
cttcactctgggggcagcatgcagccccctctaaactggctgcggagtcccccctacaat
gtgtctgctctgatttcagagaacataaacccctacatctgttatgaaatctccgtgtat
gcactgtcagggcaccagggaggatgcagctctatccagggtaactctgagcacaaagca
ccactgagtggccccaatattaatgccatcttagaggaaaaggggaacattttaatttca
tgggatgaaattccagcccaggagcaaaggggctgcatcctccattacaggatatattgg
aaggaacggaactccagttcccagcctcaactttgtgaaattccctatagggtctcccca
aattcacatccaataaacagcctacagcccaaagtgacatacatcctgtggatgacagct
ctgacagctgctggtgaaagtccccatggaaatgagagagaattttgtctacaaggtaaa
ggcagttggggcgcatttgcggcaccaagcatttgcactgctgtcatcgtggtgggtgtt
cttttctcaaggtgttatgtccggcaaaaggtatttgttctcttttcagccctcagacct
cagtggtgtagcaaagaaattccagacccggcaaacagcacttgggccaagaaatatccc
actgtggaggagaagacacagctgcccttggacaggctcctgacagactgggccactcct
gaagaacccgagaccctggtcatcaacgaagtccttcaccaagtaacccctatcttcaga
catccccatcaccccaactggccagaaaagggacgaggagtccaaggtcattatacctct
gaggaagacattcgttacaatgcctcaagccccccacctccaagacctctcacagcagag
acaggacaactagtggatctatacaaggttctagggaacagaactcctgactcaaagtca
gggcacccagccagccccttggttgtcctcccagtggactatgttcccacccacggaggc
tatttacccaccaacacagattatcttccttcacgtgaagcttctatagccgaccatctg
gaagaactggagcctcagcacatctctctctcagtttttccctcaagttcccttcacccc
ttctcctgtggcaagaaactgactctggatcggttaaagatggggagcagctccctaatg
ccgtga

KEGG   Manis javanica (Malayan pangolin): 108405149
Entry
108405149         CDS       T06054                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405149 (IL4R)
   04151 PI3K-Akt signaling pathway
    108405149 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108405149 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108405149 (IL4R)
   04658 Th1 and Th2 cell differentiation
    108405149 (IL4R)
   04659 Th17 cell differentiation
    108405149 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108405149 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108405149 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108405149 (IL4R)
   04090 CD molecules [BR:mjv04090]
    108405149 (IL4R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108405149 (IL4R)
CD molecules [BR:mjv04090]
 Proteins
  108405149 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 108405149
NCBI-ProteinID: XP_017528636
LinkDB
Position
Unknown
AA seq 891 aa
MCLSSQDWLYPVCPFQYPPQANSVAKGGKRSRKPVGLRRSPPRPLPDCCWLLTLQDSQLT
SPQMKRQVPQDLPMGWLRSRLMFPVSWLILVWVAGSGSVKVLNAPTCFSDYIFTSTCEWK
MDGPTNCSNNLRLSYQLNFEGFENHTCVPENRESTVCVCTMLIAEPVIADVYQLDLWAGR
QQLWSDSFKPSSHVKPRAPGNLTIHPTSQTWVLTWSNPYPDENYLHRELTYLVNVSNEHD
PADFRIYNVTYMEPTLRLVASTLKSGASYSARVRAWAQIYNSTWSEWSPSTNWTNYYKPW
EQRLSLGISIACVIILAVCPVCYISIIKIKKEWWDQIPNPAHSALVAIVIQDSQVPLWGK
QSRGQEPAKCLHWKTCLTKLLPCLLEHGMEKDEDSSKAAKNGPFQGPGKPAWHPVEVSKM
VLWPEDISVVRCVEIFEAQVGNEEEEVEEDKESFCPSPENSGSSFQEGREGIAARLTEHL
FLDILEGENGGFCPQGLGELCLPPPSGSTQMPWAEFPSEEPQEAPSLGKEQTFNPESNPL
ATLTQSPASLAFTETPSVVTDNPAYRRFSDFLSQSSGSGELNSDPQLAECLEEADSSVLS
AVQPSEPPTAPQPQLETWEQILRQSVLQHRAAPAPASAPTSAYRELVHMVGPRRLQDSGV
AGFGSSGEAGYKAFSSVITNSAICPGTSRIEASNGEGGYRPFQSLTPGCPAASAPVPGPL
FTFGLDMEPPHSPQNSFFPSSNPEHFGLEPVVKGEDSQKALLCPEPATEPLRDDLGSGIV
YSALTCHLCGHLKQCHGQEEHGKAILASRCCGCCCGDRSSPSVSPLRALDPLPGGVPLGA
SLPPAPLEPLGTSEEGKSPLFFPPDPSNTPSLSHTPKMVMLSTGPTGTSTS
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgtgcctttcatcacaggactggctgtatcctgtctgcccattccagtaccccccgcaa
gccaattcagtggctaagggagggaaaaggagcaggaagcctgttgggctcaggaggagc
cctcctcggccgcttcccgactgctgctggcttctgacacttcaggactcgcaactcacc
tccccccagatgaaaagacaggtgcctcaggatctcccaatggggtggcttcgctctagg
ctcatgttccctgtgagctggctgatcctggtgtgggtggcaggctctgggagtgttaag
gtcctgaatgcgcccacttgcttctcagactacatcttcacctccacctgtgagtggaag
atggatggtcccaccaactgcagcaacaacctccgcctgtcctaccagctgaattttgaa
gggtttgaaaaccacacgtgtgtccctgagaacagagaaagcacggtttgcgtgtgcact
atgctgattgctgagccggtcatagcggacgtctatcagctagacctgtgggctgggagg
cagcagctgtggagcgacagcttcaagcccagctcccatgtgaaacccagggccccggga
aacctcacgatccaccccacctcccagacctgggtgctgacgtggagcaacccgtaccct
gatgagaattacctgcatcgggagctcacctacctggtcaacgtttcaaatgaacatgac
cctgcggatttcagaatctataatgtgacctacatggagcccaccctccgcttggtggcc
agcaccctaaagtctggggcttcctacagtgcacgagtaagggcctgggcccagatctac
aatagcacttggagtgagtggagccccagcaccaactggactaactactacaagccctgg
gagcagcgcctctcacttggcatcagcattgcctgcgtcatcatcctggctgtctgccca
gtctgctatatcagcattatcaagattaagaaggaatggtgggaccagatccctaaccca
gcccacagtgcactcgtggccattgtcatccaggactcccaggtgccactgtggggaaaa
cagtcccgaggccaggaaccagccaagtgcctacactggaagacttgtcttaccaagctc
ctgccctgtttactggagcatggaatggaaaaggacgaggattcctccaaggctgccaaa
aatgggccttttcagggtcctggaaaacctgcatggcaccctgtagaggtcagcaagatg
gtcctctggccggaagacatcagtgtggtgcggtgcgtggagatctttgaggcccaggta
gggaatgaagaggaggaggtggaagaagataaagagagcttctgcccatcgcctgagaac
agtgggagcagcttccaggagggcagggaaggcatcgcggcccggctaacggagcacctg
ttcctggacattcttgagggtgagaatgggggcttctgcccacagggcttgggggagttg
tgccttcccccaccgtcaggaagtacccagatgccctgggctgagttcccaagtgaggag
ccccaggaggcaccgtccctgggcaaggagcagacttttaacccggagtcaaatccactg
gctactctgacacaaagcccagccagcctggctttcacagagacgccttctgtagtcaca
gacaatcccgcttaccgccgcttcagcgactttctgagccagtcgtcaggttctggagag
ctcaactcagacccacagctggccgagtgcctggaggaagcggactccagtgtcctctct
gccgtgcagccctctgagccacccacagcaccccagccacagctggaaacctgggagcag
attctccgccagagtgtgctccagcacagggcagccccagcccccgcttcagcccccacg
agtgcctaccgggagcttgtgcacatggtggggccgcgcagactgcaggacagtggggtg
gcgggctttggctcttcgggagaagctgggtacaaggccttctccagtgtgatcactaac
agtgccatctgcccagggacatctcggattgaggccagtaatggggaagggggctacagg
cccttccagagcctcactcctggctgtcctgcagcttctgccccagtccctggccctctg
ttcacctttggactggacatggagccacctcacagccctcagaactcattcttcccaagc
agcaacccagagcactttggcctggagccagtggtaaagggtgaggatagccagaaggcc
ctgctctgcccagagccagccacagagcccctcagggatgacctggggagcggcattgtg
tactcagcccttacctgccacctctgtggccacctgaagcagtgtcatgggcaggaagag
catggcaaggccatcctagccagccgctgctgtggctgctgctgtggagacaggtcctca
ccctcagtgagccccttgagggccctagaccctctgccaggtggggttccactgggggcc
agcctccctccagcccccttggaacccctgggcacgtcagaggagggtaaatcacccctg
ttcttcccgcctgaccccagcaatactccaagtttaagccacactcccaaaatggtaatg
ctctccacagggcccacaggcacgagcacttcctaa

KEGG   Manis javanica (Malayan pangolin): 108405151
Entry
108405151         CDS       T06054                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405151 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108405151 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108405151 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    108405151 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108405151 (IL21R)
   04090 CD molecules [BR:mjv04090]
    108405151 (IL21R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108405151 (IL21R)
CD molecules [BR:mjv04090]
 Proteins
  108405151 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 108405151
NCBI-ProteinID: XP_017528640
LinkDB
Position
Unknown
AA seq 543 aa
MLRVCAAPVVLLALQGAWGCLDLACYTDYFQTITCILQTWAVHPGTLTLTWQDPYGELED
EVTSCHLHQSTHNTTHTKYMCHMDVFPFMADDIFNVNMTDRSGNNSQECNSFILAESIKP
SPPCNVTVTFSGSYNISWSSDYDSYNFYALKGKLQYELQYRKLGDPWALSPGRKLISEDS
RSVSLLALEFSQGSSYELRVRAGPQPGSSFQGTWSEWSNPVIFRIQLDEMKGDRRAYLLY
LLLLILPPVLVFLGLKIHLPWRLWKKVVQVPSPEQFFQSLYVRHSGDFKKWVGTPFTASS
LELRPRSPEVPSALEVYSCCPPWSAAKALGPVGLSEPAELVEADGVPEPGSWDAAPSTTG
SVGSSAYSQERDRPYGLVSIDTVTVVDAEGPCVWPCTCGDDGYPALNLNTSLEAGPGTED
PLLGMGATVLSCGCVSASGLAGLGGPLGSLLDRLTLPLEDEVGWAPGPLWGGGLPQGVSD
SEAGSPPARLDMDTFDSGFAGSDCDSPVECDFTSPREEGPPRSYLRQWVVMAPPPVGPEP
QAS
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgctgcgtgtctgtgctgcccctgtggtcctgctggcgctccagggcgcctggggttgc
ttagacctcgcctgctacactgattactttcagaccatcacctgcatcctgcagacatgg
gccgtccaccctggcacgctcaccctcacctggcaagacccttatggagaactggaggac
gaggtcacatcctgccacctccaccagtccacgcacaacaccacgcatacaaagtacatg
tgccacatggatgtgttccccttcatggctgacgacattttcaacgtcaatatgacggac
cggtctggcaataactcccaggaatgcaacagctttatcctggctgagagcatcaagcca
tctcccccttgcaacgtaactgtgaccttctcaggaagttataacatctcctggagctcc
gattatgattcctacaatttctacgcgctgaagggcaagcttcagtatgagctgcagtac
aggaagctgggagacccttgggctctgagtccaggaagaaagctgatctctgaggactcc
agaagcgtctctctcctcgccttggagttcagccagggctcaagctatgagctgcgggtg
agggcagggcctcagcccggctcctccttccagggcacctggagtgagtggagtaaccca
gtcatctttcgcatccagctggatgagatgaagggagaccggcgtgcttacctgctgtac
ctccttctgctcatccttcccccagtccttgtcttcttaggcctgaagatccacctgcct
tggaggctgtggaagaaggtggtgcaggtgcccagcccagaacagttcttccagtccctc
tacgtgagacacagtggagacttcaagaaatgggtgggcactcccttcactgcctccagc
ctggagctgagacccaggagcccagaggtgccctcagccctggaggtgtacagttgctgc
cccccgtggagtgcagccaaggcactggggcctgtggggctgtcagagcctgcagagctg
gtggaggctgacggcgtgcctgagccgggctcctgggatgcagccccctccactacaggc
agtgtgggcagctcagcgtacagccaggagagggaccgcccgtacggcctggtatccatc
gacacagtgaccgtggtagatgcagaggggccatgtgtctggccctgtacctgtggggat
gatggctatccagccctgaacctgaacaccagcctggaggctggcccaggcactgaggac
ccgctcttgggcatgggggccacggttctgtcctgtggctgtgtctcagccagtggcctt
gctgggctgggaggtcccctgggtagcctcctagacaggctgacactgccccttgaagat
gaagtgggttgggccccagggccactctggggtggtgggctgccccaaggggtgtctgat
agtgaagcaggctcacccccagcccgcctggacatggacacgtttgacagtggctttgcg
ggctctgactgtgacagccccgtggagtgtgacttcaccagccccagggaggaagggccc
ccccggagctacctccgccagtgggtggtcatggcccctccccctgtgggacctgagccc
caagccagctag

KEGG   Manis javanica (Malayan pangolin): 108405848
Entry
108405848         CDS       T06054                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405848 (PRLR)
   04151 PI3K-Akt signaling pathway
    108405848 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108405848 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    108405848 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108405848 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108405848 (PRLR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108405848 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3 GHBP
Other DBs
NCBI-GeneID: 108405848
NCBI-ProteinID: XP_017529696
LinkDB
Position
Unknown
AA seq 642 aa
MKSYSEPLIHFLRKEMGANMKGNVASTIVSILLLFLNTHLLNGQSPPGKPEIFKCRSPEK
ETFTCWWKPGTDGGLPTNYTLTYRKEGETLTHECPDYKTSGPNSCYFNKKHTSIWTIYII
TVNATNQVGSISSDPRYVDVTYIVEPDPPVNLTLELKQPEDRKLYLWMKWLPPTLVDVRS
GWLTLQYEIRLKPEKAAEWETHFAGQQTQFKVLSLYPGQKYLVQVRCKPDHGFWSEWSPE
SSMQIPNDFTMKDTIVWIFVAVLSAVICLIMVWAVTLKGYSMVTCILPPVPGPKIKGFDT
HLLEKGKSEELLNALGCQDFPPPSDCEDLLVEFLEVDDSEDQQLMPAHSKEHHGQGMKPA
HLDPDSDSGRGSCDSPSLLSKKCEEPQANPCTFHTPEDVEKPRNPEPNVTLTWDPQSIGL
EGNIPYFCADGSKSSTWPLPQLPSQNNPGSSYHNLADVCELATVMAGASATLLDKTDNHA
FKSLETIETGGEGKAAEQREGDHSHAWTGQDTAWLLPQEKTTFISAKPLDYVEIHKVNKD
GALSLLPKQKEDSDETEKPGAPEPSKEYAKVSKVIEGSILLLVQDPQARNPALFEEPAKE
APPSCQQSQAEKDLASTTSSNCRLQLGGSDYLDPTCFMQPFQ
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgaagagctacagtgaacctctgatacatttcttgcggaaggagatgggagccaacatg
aaggggaatgtggcatccacaattgtttccattttgctactttttctcaacacccatctt
ctgaacggacaatcacctcctggaaaacctgagatctttaaatgtcgttctcctgaaaag
gaaacattcacttgctggtggaagcctgggacagatggaggacttcccaccaattacact
ctgacttaccgcaaggaaggagagacactcacccatgaatgtccagactacaaaaccagt
ggccccaactcctgctattttaacaagaagcacacctccatatggacaatatacatcatc
acagtaaacgccacaaaccaggtgggaagcatttcctcggacccacgttatgtggatgtg
acttatatagttgaaccagaccctcctgtgaacctgactttggaattaaaacagccagaa
gacagaaaactctacctgtggatgaaatggcttccacctaccctggtcgacgtaagatct
ggttggctcacactccagtatgaaattcgcttaaaaccagagaaagcagctgagtgggag
acacattttgctgggcagcagactcagtttaaggttctcagcttatatccaggtcagaaa
taccttgtccaggttcgctgcaagccagaccacggattctggagtgagtggagcccagag
agctccatgcagatacctaatgatttcaccatgaaagataccatcgtgtggatctttgtg
gctgtcctttctgctgtcatctgtttgattatggtctgggcagtgactttgaagggctat
agcatggtgacctgtatccttccacccgttcctgggccaaagataaagggatttgatacc
catctactggagaagggcaagtctgaagaactcctgaatgccctgggatgccaagacttc
cctcctccctctgactgtgaggacctgctggtggagtttttagaagtggatgacagtgag
gaccagcagctgatgccagcccattcaaaagaacaccacggtcaaggtatgaagcccgca
cacctggatcccgacagtgattctggccggggcagctgcgacagtccttctcttttgtcc
aaaaagtgtgaggaaccccaggcaaatccctgcacattccacactcctgaggacgttgag
aagcctcggaatcctgaacccaatgttaccctcacctgggacccccagagcataggcttg
gaaggcaacattccctacttctgtgctgatggatccaaatcttcaacgtggcctttaccg
cagctccccagccaaaacaaccccggatcttcgtaccacaacctcgctgatgtgtgcgag
ctggccacggtcatggcaggggcttcagccacattgttggacaaaacagacaatcatgct
ttcaaatccttggaaaccattgagactggaggggaaggtaaggcagctgagcagagggag
ggggatcactcccatgcctggactggccaagacacagcatggctgctgccccaggaaaaa
accacttttatctctgctaagcccttggattatgtggagatccataaggtcaacaaagat
ggagcactgtcattgctcccgaaacagaaagaggacagtgacgagacggagaagccaggt
gctcctgaacccagtaaagagtatgctaaggtgtccaaggtgatagagggcagcatcctg
ttgttagtgcaggatccacaagctcgaaacccggctttgtttgaagaaccagccaaggag
gctccaccatcctgtcaacagagtcaggctgaaaaagacctggcttccaccacatcaagc
aactgcagactccagctcggcgggtcggattacctggaccccacatgctttatgcagccc
tttcagtga

KEGG   Manis javanica (Malayan pangolin): 108406161
Entry
108406161         CDS       T06054                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04152  AMPK signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108406161 (LEPR)
   04152 AMPK signaling pathway
    108406161 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108406161 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    108406161 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108406161 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108406161 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108406161 (LEPR)
   04090 CD molecules [BR:mjv04090]
    108406161 (LEPR)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108406161 (LEPR)
CD molecules [BR:mjv04090]
 Proteins
  108406161 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3 SRTM1
Other DBs
NCBI-GeneID: 108406161
NCBI-ProteinID: XP_017530196
LinkDB
Position
Unknown
AA seq 903 aa
MICQKFCIALLHWEFIYVITAFKLAYPVTPWRFKLSCMPPNTTYDFLLPAGISKNTSHPN
GYYEAVVEAKFNSSDTYFSNLQSKTTFYCCFWSEEDQNCSVHADNIEGKAFVSTVSSLVF
QQIGANWNIQCWMKEDLKLFICYVESLFKNPSKNDDLKVHLLYVLPDVLEESPLVSREGR
FHVAQCSCSARECCECQVPVPTAKLSCTLFMYLKITSGGINFQSPLMSVQPITVVKPDPP
LGLHMEITDTGNLKISWSSPTLVPFQLQYQVKYSENSTVNTRKTDEIVSATSLLVDRVLP
GSSYEVQVRGKRLDGPGIWSDWSSPLIFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKI
VSSKKIVWWMNLAEKIPQSQYNAVGDHVSKVTFPNLNATKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWATNAIQALVGSSLQLRYHRSSLYCSDVPAVH
PISEPKDCHLQRDGSYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVVPDSVVKPLPP
SSVKAEITVNIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDSKSKSTSLPV
PDLCAVYAVQVRCKRLDGMGYWSNWSTPAYTVVLDIKVPVRGPEFWRIINEDIMKKERNV
TLLWKPLMKNDSLCSVRKYVVKHHTSHNGTWSEDVGNRTRFTFLWTEQAHSVTVLAVNSV
GTSHANFNLTFSWPVSKVNIVQSLSTYPLNSSCVILSWILSPSDYNLMYFIIEWKILNED
NEIKWLRIPSSVKKYYIHDHFIPIEKYQFSLYPIFTEGVGKPKIINSLTPDDIEKHQNDA
GLYVIVPIIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKCFILSKQRT
DIL
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtatagctttgttacattgggaatttatttatgtgataact
gcatttaagttggcatatccagttactccctggagatttaagttgtcttgcatgccacca
aatacaacctatgatttcctgctgcctgctggaatctcaaagaacacttcccacccaaat
ggatattatgaggcagttgttgaagctaaatttaattcaagtgacacctacttttctaac
ttacaatctaaaacaactttctactgttgcttttggagtgaggaagatcaaaactgctct
gtacatgcagacaacattgaagggaaggcatttgtttcaacagtaagttctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgttatgtggagtcattatttaagaatccttccaagaatgatgaccttaaggtccat
cttttatatgttctacctgacgtgctggaagagtcgcctttggtctcccgggaaggccgt
ttccatgttgctcagtgcagctgcagtgctcgtgaatgttgtgaatgccaggtgcctgtg
ccaacagccaagctcagctgtacgctctttatgtatttgaaaatcacatctggtggaata
aattttcagtcacctctgatgtcggttcagcccataactgttgtgaagcctgatccacca
ttaggcttgcatatggaaatcacagacactggtaatctaaagatttcttggtccagccca
acattggtaccatttcaacttcaatatcaagtgaaatattcagaaaattctacagttaat
acgagaaagactgatgagattgtctcagctacatctctgctagtagaccgggtgcttcct
gggtcttcatatgaggttcaggtgagaggcaagagactagatggcccagggatctggagc
gactggagcagcccccttatctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgggtctaacgtttcttttcattgcatctataaaaatgaaaacaagatt
gtctcctcaaaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tataatgctgtgggtgatcatgttagcaaagttacttttcccaatttgaatgcaaccaag
cctcgagggaagttcacctatgatgcagtgtactgctgcaatgagcatgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatgggcaactaatgcaatccaagcacttgtgggaagt
tctctgcagttgaggtatcataggagcagcctttactgttctgatgttccagctgttcat
cccatatctgaacctaaagattgccacttgcagagagatggttcttatgaatgcatattt
cagccaatctttctattatccggctatacaatgtggattagaatcaatcactctttgggt
tcacttgactctccaccaacatgtgtcgtccctgattccgtggtgaaaccactgcctcca
tccagtgtgaaagcagaaattactgtaaacattggattattgaagatatcttgggaaaaa
cctgtcttcccagagaataatcttcagttccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtgtatgattcaaaatcaaaatctaccagtctgcctgtg
ccagacctatgtgctgtctatgccgttcaggtgcgctgcaagaggctagatgggatggga
tactggagtaattggagtactccagcctacacagttgtcctggatattaaagttcctgtc
agaggacctgaattttggagaataattaatgaagacatcatgaaaaaagagagaaatgtc
actttactttggaagcctctgatgaaaaatgactcattgtgcagtgtgagaaaatatgtg
gtaaaacaccatacttcccacaatggaacatggtcagaagatgtgggaaatcgcactaga
ttcactttcctatggacagagcaagcccattctgttacagtcctggctgtcaattcagtt
ggtacttctcatgcaaattttaatctgacgttctcatggcctgtgagcaaagtaaatatc
gtgcagtcactcagtacttatcctttaaacagcagttgtgtgattctttcctggatacta
tcacccagtgattacaatctgatgtattttataattgagtggaaaattcttaatgaggac
aatgaaattaaatggcttagaatcccttcatctgttaagaagtattatatccatgatcat
ttcatccccattgagaagtatcagttcagtctttatccaatatttacggaaggagtgggg
aaaccgaagataattaatagtcttaccccagatgatattgaaaaacaccagaatgatgca
ggtctatatgtaattgtgccaataattatttcttcttcaatcttattgcttggaacgttg
ttaatatcacaccaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaat
tgttcctgggcccaaggacttaattttcagaagtgttttattttatctaaacagagaacg
gacattctttga

KEGG   Manis javanica (Malayan pangolin): 108406292
Entry
108406292         CDS       T06054                                 

Definition
(RefSeq) epidermal growth factor receptor-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04934  Cushing syndrome
mjv05160  Hepatitis C
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108406292
   04012 ErbB signaling pathway
    108406292
   04014 Ras signaling pathway
    108406292
   04015 Rap1 signaling pathway
    108406292
   04630 JAK-STAT signaling pathway
    108406292
   04066 HIF-1 signaling pathway
    108406292
   04068 FoxO signaling pathway
    108406292
   04020 Calcium signaling pathway
    108406292
   04072 Phospholipase D signaling pathway
    108406292
   04151 PI3K-Akt signaling pathway
    108406292
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108406292
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108406292
   04520 Adherens junction
    108406292
   04540 Gap junction
    108406292
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108406292
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108406292
   04915 Estrogen signaling pathway
    108406292
   04921 Oxytocin signaling pathway
    108406292
   04926 Relaxin signaling pathway
    108406292
   04928 Parathyroid hormone synthesis, secretion and action
    108406292
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108406292
   05206 MicroRNAs in cancer
    108406292
   05205 Proteoglycans in cancer
    108406292
   05230 Central carbon metabolism in cancer
    108406292
   05231 Choline metabolism in cancer
    108406292
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108406292
  09162 Cancer: specific types
   05210 Colorectal cancer
    108406292
   05212 Pancreatic cancer
    108406292
   05225 Hepatocellular carcinoma
    108406292
   05226 Gastric cancer
    108406292
   05214 Glioma
    108406292
   05218 Melanoma
    108406292
   05219 Bladder cancer
    108406292
   05215 Prostate cancer
    108406292
   05213 Endometrial cancer
    108406292
   05224 Breast cancer
    108406292
   05223 Non-small cell lung cancer
    108406292
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108406292
  09172 Infectious disease: viral
   05160 Hepatitis C
    108406292
   05171 Coronavirus disease - COVID-19
    108406292
   05163 Human cytomegalovirus infection
    108406292
   05165 Human papillomavirus infection
    108406292
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108406292
   01522 Endocrine resistance
    108406292
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108406292
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108406292
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108406292
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   108406292
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108406292
  Exosomal proteins of pancreatic cancer cells
   108406292
  Exosomal proteins of bladder cancer cells
   108406292
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like Borrelia_P83
Other DBs
NCBI-GeneID: 108406292
NCBI-ProteinID: XP_017530403
LinkDB
Position
Unknown
AA seq 681 aa
MPSVKVTGWRPSHNDTVTGFMRAGECSCCLWEHSQQSLIETAFLGSRNNLKRVDAMWKVC
QGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAGYVLI
ALNTVEKIPLENLQIIRGNVLYENTHALSVLSNYGVNKTGLQELPLRSLQEILQGAVRFS
NNPVLCSVDTIQWRDIINGDFLGNMSMDFQNPLGSCQKCDPGCPNGSCWGAGKENCQKLT
KLICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYN
PTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSYEVEEEGVRKCKKCEG
PCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTRTPPLDPKE
LDILKTVKEITGFLLIQAWPENRTDLHAFENLEVIRGRTKQHGQFSLAVVGLDIKSLGLR
SLKEISDGDVIISGNQNLCYANTIHWKKLFGTSSQKTKIINNKGEKDCKAIGHICNSLCS
SEGCWGPEPKDCVSCRNVSRGRECVEKCNVLEGEPREFVENSQCIQCHPECLPQTMNITC
TGHGPDSCVKCAHYIDGPHCVKTCPAGVMGENNTLVWKFADANHVCRLCHSNCTYGKLII
SSSIMASSSLFHKFQIVLKGP
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgccaagtgttaaggtgactggctggagaccatcccataatgacaccgtcacaggcttc
atgcgggccggagagtgttcgtgctgcctctgggaacacagtcaacagtccctcatagaa
acggccttcctgggatcgagaaacaacctaaagagagtggacgcaatgtggaaagtttgc
cagggcacaagtaacaagctcacccagttgggcacttttgaagaccactttctgagcctc
cagaggatgttcaataactgtgaggtggtcctggggaacttggaaattacttacatgcaa
aggaattatgacctttccttcttaaagactatccaggaggttgccggctatgtactcatt
gctctcaatacagtggagaaaattcctttggaaaacctgcagatcatcaggggaaacgtg
ctctatgaaaacacccatgccttatcagtcttatccaactatggtgtcaacaaaactgga
ctgcaagagctgcccctgaggagcttacaggaaatactgcaaggtgctgtgcgcttcagc
aacaacccggtcctctgcagtgtggacaccatccagtggagggacatcatcaacggtgac
ttcctgggcaacatgtcgatggactttcagaacccactgggcagctgccaaaagtgtgat
ccaggctgccccaatggaagctgctggggtgctgggaaggagaactgccagaaactgacc
aagctcatctgtgcccagcagtgttcagggcgctgccgcggcaagtcccccagcgattgc
tgtcacaaccagtgtgccgcaggctgcacagggccccgggagagcgactgcctggtctgc
cgcaggttccgtgatgaagccacgtgcaaggacacctgcccaccgctcatgctgtacaac
cccaccacgtaccagatggacgtgaacccagagggaaagtacagcttcggtgccacctgt
gtgaagaaatgcccccgtaactacgtggtgacagaccatggctcctgcgtccgcgcctgc
agttccgacagctacgaggtggaggaggagggtgtccgcaaatgtaaaaagtgtgaaggg
ccttgtcgcaaagtttgtaatggaataggaattggtgaatttaaagacacactttccata
aatgctacaaatattaaacacttcaaaaattgcacctcaatcagtggagatcttcatatc
ctgccggtggcatttaggggggactccttcacacgtactccacctctggatccaaaggaa
ctggatatcctaaaaactgtgaaggagatcacagggttcttgctaattcaggcctggcca
gaaaacaggactgacctccatgcatttgagaacctagaggtcatacgtggaagaacaaag
caacatggccagttttctctcgcagttgtcggcctggacataaagtccttgggattacgt
tccctcaaggagataagtgatggcgatgtgataatttcaggaaatcaaaacttgtgctat
gcaaatacaatacactggaaaaaattgtttgggacatcaagtcagaaaaccaaaattata
aacaacaaaggtgaaaaagactgcaaggctataggccacatctgtaactcattatgctca
tcagagggctgctggggcccggagcctaaggactgtgtgtcctgccgaaacgtcagccgc
ggcagggaatgtgtggagaagtgcaacgttctggagggtgagccgagggagtttgtggag
aattcccagtgcatacagtgccatccagaatgcctgccccagaccatgaatataacctgc
acgggacacggaccagacagctgtgtaaagtgtgcccactacatcgatggcccacactgc
gtcaagacctgccccgctggagtcatgggggaaaacaataccctggtctggaagtttgcg
gatgccaatcacgtgtgccgtctgtgccattcaaactgtacctacgggaaactgatcata
tcttcttcaataatggcatcttcatctctcttccacaagtttcagattgtattaaaagga
ccataa

KEGG   Manis javanica (Malayan pangolin): 108406858
Entry
108406858         CDS       T06054                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha isoform X1
  KO
K05072  interleukin 7 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04068  FoxO signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
mjv05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108406858 (IL7R)
   04068 FoxO signaling pathway
    108406858 (IL7R)
   04151 PI3K-Akt signaling pathway
    108406858 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108406858 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108406858 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108406858 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    108406858 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108406858 (IL7R)
   04090 CD molecules [BR:mjv04090]
    108406858 (IL7R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108406858 (IL7R)
CD molecules [BR:mjv04090]
 Proteins
  108406858 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 bMG1
Other DBs
NCBI-GeneID: 108406858
NCBI-ProteinID: XP_017531309
LinkDB
Position
Unknown
AA seq 468 aa
MIILGTAFGMVFYLLQAVSGESGYAQNAAGFSSPEGFEDAELDYSFSCYSQLEVDGHSEH
LLICAFDDPDINSTNLEFEICDSLLDIDCLNFSKLQEVYFIKTKIFELIGDSNICVKFKG
KNINCRKVNIVKIVKPEAPFDIRVVYREGANDFVVTFNTSHLKKKYVKELMHEVAYRQEK
NESDWMHVNLSSTKLTLLQRKLQPDAMYEIKVRSIPNPIYFEGFWSEWSPSFHFRTPLQA
RGPAGVMDPVLLIISIMSFFSVVLMVTLAFVLWEKRIKPIVWPSLPDHKKTLEQLCKKPQ
RNLNVSFNPESFLDCQIHRVDGIQAKDEAEGFLHVTFPPQLEESEKQRLGRSVQDPSWPS
EHAVITPKTFRQDPIPQCQAGDISVCDDPMLPSSKSPGFREGGKNEPHVYQGLLLGPGTT
NRTLPPPFPFQSGVLTWTPAAQGQPILTPSRSSQEEAYVTMSSFYQNQ
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgataattctaggtacagcctttggtatggttttctatttacttcaagccgtttctgga
gaaagtggctatgcacagaatgctgcaggtttttcctccccagaaggctttgaagatgcg
gaattggactactcattctcgtgctacagtcagttggaggtggacggccactccgagcac
ttgctgatctgtgcttttgatgacccggacatcaacagcaccaatctggaatttgaaata
tgtgattcccttttggacatagactgcctgaattttagtaaactgcaagaggtatacttc
atcaagacaaagatattcgaactgattggagacagcaatatatgtgtgaagtttaaagga
aagaacataaattgcagaaaagttaacatagtcaagatagttaaacctgaggctcctttt
gacataagagttgtctaccgcgagggagcaaatgactttgtggtgacatttaatacatca
cacttgaaaaagaagtatgtgaaagaattgatgcacgaggtagcctaccgccaggaaaaa
aatgaaagtgactggatgcatgtgaatttgtccagtacaaagctgacactcctacagagg
aagctacaacctgatgccatgtatgagattaaagtgcgctccattcctaaccccatctat
tttgaaggcttctggagtgaatggagtccgagttttcacttcagaactccgcttcaggcc
agaggccccgctggggtgatggatcctgttttactaattatcagcattatgagtttcttc
tctgtggttctgatggtcaccttggcctttgtgttatgggaaaaaagaattaaacctatt
gtgtggcccagtctccctgatcataagaagactctggaacaactgtgcaagaaaccacaa
aggaatttgaatgtaagttttaatcctgaaagtttcttggactgccagattcatagggta
gatggcattcaagctaaagatgaagcagaaggctttcttcatgtcacttttccaccacaa
ctagaggagtctgaaaagcagaggcttggaagaagtgtgcaggaccctagctggccatct
gaacatgcagtcatcaccccaaaaacttttagacaagatccaatcccccagtgccaggct
ggggatatcagtgtgtgtgatgaccctatgctcccctcctccaagtccccaggcttcagg
gaaggtggcaaaaatgagcctcatgtgtaccaggggctgctgcttggccctggaactaca
aatagaaccctgccccctccatttcctttccaatcaggagtcctgacatggactccagct
gcccagggacagcccatcctcactccctccagatcaagtcaggaagaagcatacgtcacc
atgtccagcttctaccaaaaccagtga

KEGG   Manis javanica (Malayan pangolin): 108407017
Entry
108407017         CDS       T06054                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108407017 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108407017 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108407017 (MPL)
   04090 CD molecules [BR:mjv04090]
    108407017 (MPL)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  Prolactin receptor family
   108407017 (MPL)
CD molecules [BR:mjv04090]
 Proteins
  108407017 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 108407017
NCBI-ProteinID: XP_017531574
LinkDB
Position
Unknown
AA seq 643 aa
MPSWAFLVVTSCLLLASQNLAQVTSQDASLLASDSEPLSCFSRTFEDLTCFWDEEEAAPN
GTYQLLYAYPGEKPRACPLSSQNMLPFGTRYVCQFPAQDEVRLFFSLHLWVKNVLLNQTL
TQRVLFVDSVGLPAPPSNIKAMGGSQPGELQISWEAPAPAIGDFLRHELRYGPEDSRNTT
GPIVLQLLSSETCCPALWRPNPAPALDQLPCVQPMMPQQDGPEQTSPTREAPSPAVMGGS
CLISGLQPGTSYWLQLRSQPDGISLHGSWGSWSLPVTVDLPGDAVEIGLQCFTLNLKNIT
CQWKQQDHISSQGFFYHSRARCCPTDRDTTWEKCEEEKNPGLQPSQFSRCQFKSRNDSVI
HILVEMTTAQGVHSYLGSPFWIHQAVVIPTPNLHWREVSSGQLELEWQHSSSWAAQETCY
QLRYTGEGHQDWKVLEPPLGAQGETLELRPRSRYRLQLRARLHGPTYQGPWSTWSDPVRV
ETASETAWISLVTTLLLVLGLSALLGLLLLRWQFPAHYRSLRHALWPSLPDLHRVLGQYL
TDATALSPPKTTVSDAYEEVEPSLLEILPKSSEKTPLPLYSSQAQMDYRGLPTSCLGTMP
LSMCPSMAETGSYCTTHIANHSYLPLSCWQAPCSHSPGQIQTL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgccctcctgggccttcttggtggtcacctcctgcctcctcctggcctcccaaaacctg
gcacaagtcaccagccaagatgcctccttgctggcctcggactcagagcccctgagctgt
ttctctcgaacatttgaggaccttacttgcttctgggatgaggaagaggcagcacccaat
ggaacataccagctgctatatgcctacccaggggagaagccccgtgcctgccccctgagt
tcccagaacatgcttccctttggaacccgatacgtgtgccagtttccagcccaggatgaa
gttcgcctcttcttttccctgcacctctgggtgaagaatgtgttgctgaaccagactctg
acccagcgggtgctctttgtggatagtgtgggcctgccagctccccccagtaatatcaag
gccatgggtgggagccagccaggagaacttcagatcagctgggaggccccagctcctgca
atcggtgatttcctgagacacgaactccgttatggtcctgaggattccaggaacaccact
ggtcccatagtcctgcagctcctgtcctcagaaacctgctgcccagctctatggaggccc
aatccagccccagctctggaccagcttccatgtgttcaacccatgatgccccaacaggat
ggaccagagcagacctccccaactagagaagctccatctccagcagtgatgggtggaagt
tgcctcatctcagggctccagcctggcacctcctactggctccagctgcgcagccaacct
gatgggatctctctccatggctcctggggatcctggtcactccctgtgactgtggacctg
cctggggatgcagtggaaattggactgcagtgctttaccttgaacctgaagaacattacc
tgtcagtggaagcaacaggaccacattagctcccaaggtttcttctaccacagcagggca
cgatgctgccccacagacagggacaccacctgggagaagtgtgaagaggagaaaaatcca
ggattacagccctcccagttctcccgatgccagttcaagtcacgaaatgacagtgttatt
cacatccttgtggaaatgaccacagcccagggtgttcacagctacctgggctctcctttc
tggatccaccaggcagtggtcatccccactccaaacttacattggagggaggtctccagt
gggcagctggaattggaatggcagcactcatcatcctgggcagcccaggagacctgctat
cagctgcgatacacaggagaaggccatcaggactggaaggtgttggagccacctctcggg
gcccagggagagaccctggagctgcgcccacgctctcgctaccgtttacagctgcgcgcc
aggctccacggccccacctaccaaggaccctggagcacctggtctgacccagtcagggtg
gagacggcctccgagacggcctggatctccttggtgaccactctgctcctggtgctaggc
ctcagcgccctcctgggcctgctgctgctgaggtggcagtttcctgcgcactacaggagc
ctgaggcatgccctgtggccttcactcccagacttgcaccgggtcctaggccagtacctt
acggatgccacagccctgagtccgcccaagactacagtctcagatgcctatgaagaagta
gaacccagcctccttgaaattctacctaagtcctcagagaagactcctttgcccctgtat
tcctcccaggcccagatggactaccgaggactgccaacttcttgcctggggaccatgccc
ctgtctatgtgcccatccatggctgagacagggtcttactgcaccactcatattgccaac
cattcctacttgccactgagctgttggcaggccccttgctcccattcccctggacagatc
caaaccctctag

KEGG   Manis javanica (Malayan pangolin): 108407553
Entry
108407553         CDS       T06054                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108407553 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108407553 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    108407553 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108407553 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108407553 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108407553 (IL15RA)
   04090 CD molecules [BR:mjv04090]
    108407553 (IL15RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108407553 (IL15RA)
CD molecules [BR:mjv04090]
 Proteins
  108407553 (IL15RA)
SSDB
Motif
Pfam: Sushi SKG6
Other DBs
NCBI-GeneID: 108407553
NCBI-ProteinID: XP_017532460
LinkDB
Position
Unknown
AA seq 219 aa
MCPTPTSVEHANIRIKSYNLSSRERYICNSGFKRKAGTSSLIECVFNETTNVAHWTIPNL
KCIRDPSLTHQRPPSTVAPARVTPEPESPSPPGKEPDFTSKSDTTMATKPAIVPGSRLMP
SKPPSAGTMEVVSNEPSQVPPQTTAKILEHTPSTSQEMPGTYAFNSRAVTVAISIPTGVL
CGVCVAFLLVCYKKSRQTSQTPNTEMEDMPMTGGNHGKE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtgccctactcccacgtctgtagaacacgcaaacatccggattaagagttacaacctg
agctccagggagcggtacatttgtaactcaggtttcaagcgtaaagccgggacgtccagc
ctgatcgagtgtgtatttaacgagaccacgaacgttgcccactggacaattcccaatctc
aagtgcataagagacccctccctgactcaccaaaggccaccctccacagtagcgccggca
agggtgaccccagagccagagagcccttcccctcctggaaaagagccagattttacctcc
aagtcagacaccacaatggccacaaagccagctattgtaccaggctccaggctgatgcca
tcaaaacctccttctgcaggaaccatggaggtagtcagtaatgagccctcccaagtacca
cctcagacaacagcaaagatcttggaacacactccctccacctcgcaggagatgccaggt
acatatgcattcaattccagagctgtgactgtggcaatctctatacctactggtgtgctt
tgtggagtatgtgttgcatttcttctggtatgttacaaaaaatcaaggcaaacttcccag
acacccaacactgaaatggaagatatgccaatgactggtggaaaccacggcaaggaatag

KEGG   Manis javanica (Malayan pangolin): 108409505
Entry
108409505         CDS       T06054                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv05160  Hepatitis C
mjv05162  Measles
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409505 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    108409505 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409505 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108409505 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108409505 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    108409505 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    108409505 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108409505 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409505 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108409505 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    108409505 (IFNAR2)
   05164 Influenza A
    108409505 (IFNAR2)
   05162 Measles
    108409505 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    108409505 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108409505 (IFNAR2)
   05169 Epstein-Barr virus infection
    108409505 (IFNAR2)
   05165 Human papillomavirus infection
    108409505 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108409505 (IFNAR2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IFN receptor family
   108409505 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 108409505
NCBI-ProteinID: XP_017535620
LinkDB
Position
Unknown
AA seq 520 aa
MLVSQNASAIRPRNLYPMVYISLVFGILHALPDFPGEPCVLKMTLRNFRTILSWELKNHS
VVPTHYTFWYTIMSKPEGMKIVEDCRNITRSFCDVTDVWGNMRETYVPRVDGFKGNTTLV
SCTGSFFLATHMSLEPPEFEVVGFIDHINVTVKFPPIIPKILDGEGLWFYSPLVIEEQSG
RIVKKHKPKINENVTGDFTYVIDKLIPNTNYCVSVYLEPTDLRAINRSPLKCTLLQPRQQ
SGTSESAKIGGIITMFLIAAVVTSTIITMKRIGYICLRSDFPKVLNFCNRSGWVFPELPP
LEAVAIAEVIHINRKKRVWDYNYDESDSDNEAAPRTSAGGYTMHGLIGRPLCPASTSAAP
SEDCIDSDAEEPGLPEPDADTEPLMAPGPSPWQSECTSEAYRGRGSLLQDPFSEEDGSST
EGSGDRIAFNVDLNSVFVRVLDDDSEVPAMLSFPEETVYLEGPDEMDLDEAESLLVASGD
RTQPPFPGPAAECLWPEDASSNKSDTSESDVDIGDGYIMR
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcttgtgagccagaatgcctcagcgattagaccacggaatttgtaccccatggtgtac
atcagcctcgtgtttggtattttacatgctttgcctgattttccaggtgaaccttgtgtt
ttaaagatgacattacgaaatttccggacaatcttatcatgggaattaaaaaaccattca
gttgtgccaactcactataccttttggtacacaatcatgagtaaaccagaaggtatgaag
attgttgaggactgtagaaatatcacaagatcattttgtgatgtaacagatgtgtgggga
aacatgcgtgagacgtacgtccccagagtggatgggttcaaggggaacacaacactggtc
agctgcacgggcagtttcttcctggcaacacacatgtctttggaaccaccagaatttgag
gttgttggttttattgaccacattaatgtaacagtgaaatttccacccatcatccccaag
atactagatggggaaggattatggttttactcaccacttgtcatcgaagaacagtcaggg
agaattgttaagaagcataaacccaaaataaatgaaaacgtcactggagatttcacttat
gtcatcgacaaattaattccaaacacgaactactgtgtgtctgtttatttagagcctaca
gatctgagagcaataaatagatctcccttaaaatgtaccctgcttcaacctaggcagcaa
tcagggacatcagaatctgccaaaataggaggaataatcactatgtttttaatagcagct
gttgtcacaagcaccataataacaatgaaacggattggttatatatgcttaagaagcgat
ttccccaaagttttgaatttctgtaacaggtcgggctgggtatttcctgagctgccacca
ctggaagctgtggctatagcagaggtcattcatattaacagaaagaagagagtgtgggat
tataattatgatgaaagtgacagcgataacgaagcagccccccggacaagtgcaggcggt
tataccatgcacggcctaataggcaggcctctgtgtccagcctccacctccgcagccccc
tcagaggattgcatcgactcagatgctgaggaacctggcctgcctgagcccgacgctgac
actgagcccctcatggccccagggccgagcccctggcagtcagaatgcacaagtgaggcg
tacagggggagaggcagtctgctgcaggaccccttttccgaggaggatggcagctccact
gaggggtctggggacagaattgccttcaacgtggatttaaactccgtgtttgtgagggtt
cttgatgacgactcagaagtccctgcaatgttatcatttccagaagagacagtctacctg
gagggtcccgatgaaatggatcttgatgaagcagaaagccttctggtggctagtggagac
aggacacagccacccttccctggccccgctgcagagtgcctgtggcctgaagatgcttct
tccaataaaagcgacacttctgagtcagatgttgacattggggatggttatataatgaga
tga

KEGG   Manis javanica (Malayan pangolin): 108409506
Entry
108409506         CDS       T06054                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409506 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409506 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108409506 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108409506 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108409506 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108409506 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108409506 (IL10RB)
   04090 CD molecules [BR:mjv04090]
    108409506 (IL10RB)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108409506 (IL10RB)
CD molecules [BR:mjv04090]
 Proteins
  108409506 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 108409506
NCBI-ProteinID: XP_017535624
LinkDB
Position
Unknown
AA seq 364 aa
MLKPGMALGMVPPPETVRIHSVNFKNILQWESPAFPKGNLTFTAQYQSYRKFQDMCTSTS
LNECDFSSLSKYGDHTLRVRAEFASEHSDWVNITFCPVDDTILGPPGMQVEALANSLHMR
FLAPNIENEPETWTMRNIYNSWAYNVQYWKNGSDEKCSITCQYDFEVLRNLEPWTTYCVQ
VQGFLPDRNKTGEWSEPVCEQTAKAETTPSWVAIVVLVGSVCLAFLFLLGCFALLWCIYK
KTKSTFSPGTSLPQHLKEFLGCPQHSQLLVFSFPLSDENEVFDKLSVITQASESSRQNPG
DGHSPRTPSGQGPVELASKKDAHSAGYGDTLLLLSASAGDPGSSRGPGPPEQTSDLELSD
SHDI
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcttaagccaggaatggcattaggaatggtaccccctcctgaaactgtcagaatacat
tcagttaatttcaagaacattctacaatgggagtcgcctgcttttcccaaagggaacctg
accttcacagctcagtaccaaagttatagaaaattccaagatatgtgcacaagtacttcc
ttgaacgaatgtgatttctcaagtctttccaagtatggtgaccacaccttgagagtcagg
gctgaattcgccagcgagcattcagactgggtaaacatcaccttctgtcctgtggatgac
accattcttgggcctcctggaatgcaagtagaagcacttgctaattctttacatatgcgt
ttcttagccccaaatattgagaatgaacctgaaacatggaccatgaggaatatttacaac
tcgtgggcttataatgtgcaatattggaaaaacggctctgatgaaaagtgttcaattact
tgtcaatatgacttcgaggtgctcagaaatctggagccatggacaacttactgtgttcaa
gttcaaggatttcttcctgatcggaacaaaactggagaatggagtgagcctgtctgtgag
caaacagccaaggcggaaaccaccccctcctgggtggccatcgtggtccttgtaggctca
gtgtgcctggccttcctgtttctccttggctgcttcgccttgctgtggtgcatttacaag
aagaccaagtccaccttctcccctgggacttcgcttccacagcacctgaaagagtttttg
ggctgccctcaacacagccagcttctggttttctccttcccgctctctgatgagaatgaa
gtttttgacaaactgagcgtcattacacaagcgtctgaaagcagcaggcagaaccccggt
gatggccatagccccaggaccccgtctgggcagggccccgtcgagctggcctccaagaaa
gacgcgcactcagctgggtacggtgacacgctgcttctcctgtctgcctctgcgggcgat
ccgggcagcagtcgagggccaggcccacctgagcaaacctcagatctggaactctcagac
tcgcacgacatctaa

KEGG   Manis javanica (Malayan pangolin): 108410302
Entry
108410302         CDS       T06054                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108410302 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108410302 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108410302 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108410302 (IL20RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108410302 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 108410302
NCBI-ProteinID: XP_017536789
LinkDB
Position
Unknown
AA seq 498 aa
MKNILQWSPPEGLQGVEATYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYY
AKVRAIWKTKCSKWAETGRFFPFLETQIGPPEVALTTDEKSISIILTAPEKWKENPEESS
ISMQQIYSNLKYNVSVYNTKSNKTWSQCVTNHTLVLSWLEPDTLYCVHVESFVPGPPRLA
QPSETRCVHTLTDQTSVLNIKIIFWYVLPISVTVFIFSVMGYSMYRYIHVGKEKHPANLV
LIYGNEFDKSFFVPAEKIVFNFITLSILEDCKISHKDLSLVEKSSDTANLNEPSRAQKPP
EEEGEVMHLGYASHLLDIFCESEEKTRGTSLAQQESLSRTIPTDKAVIEYEYDVRTTNVC
VEPGDQELTWQEEVSLQGNSFEQQAALADAGPQTLPQPYTPQLRDLDHLPQGHIGMEEPP
TTTLVDWDPRTGRLRIPSLSSFELDSEKYERPEYQEAPEEGLLSRLYKEQAPDKPPEEKE
TYLSQFMEEWGLYVQMGD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaagaatatcctacagtggagtccaccagagggcctgcaaggagttgaagccacgtac
actgtgcagtatttcatatatgggcaaaagaaatggctgaataaatccgaatgcagaaat
atcaatagaacctactgcgatctctctgctgaaacttctgactacgaacatcagtattat
gccaaagttagggccatttggaaaacaaagtgttccaaatgggcagaaactgggcgattc
tttccgttcttagaaacacaaattggcccaccagaggttgctttgactactgatgagaaa
tccatttctatcattctgacggctccagaaaagtggaaggaaaatccagaagaaagttct
atttccatgcaacaaatctactctaatttgaagtataatgtgtctgtatataacactaaa
tcaaataaaacgtggtctcagtgtgtgactaaccacacgcttgtgctcagctggctggag
cctgatactctgtactgtgtccatgtggagtcctttgtcccagggcctcctcgccttgct
cagccttctgagacgcgatgtgtccatactttgacagatcaaacatcagtattgaacatt
aaaatcatcttctggtatgttttgcccatatctgttactgtgtttattttttctgtgatg
ggctattccatgtacagatacatccatgttggcaaagagaaacacccagcaaatttggtt
ttgatttatggaaatgaatttgacaaaagtttctttgtacctgctgaaaaaattgtcttt
aactttatcaccctcagtattttggaggattgtaaaatttctcataaggatttaagtctt
gtggaaaaaagcagtgacacagcgaacctgaatgagcccagcagggcccagaagccccct
gaggaggaaggagaggtgatgcacttagggtatgcttcccatttgttggacatcttctgt
gagtctgaggaaaagaccagaggtacctccctagcccagcaagagtcactcagcagaaca
atacccacggataaagcagtcattgaatatgaatatgatgtaagaactactaacgtttgt
gtggagcccggagaccaagagctcacttggcaagaagaagtgtccttacaaggaaactcc
tttgaacaacaggcggctttggcagacgcaggcccgcaaacactaccgcagccatacacc
cctcagctcagagacttggaccacctgccacaggggcacataggcatggaagagccaccg
accaccacactggtcgactgggaccctcggactggcaggctgcgtataccttcattatct
agctttgaacttgactcagagaaatacgagcgccctgaataccaagaggccccagaggag
gggcttttgtccagactctacaaggagcaggctccagacaagccaccggaagaaaaggaa
acttatctctcccaatttatggaggaatgggggttatatgtacaaatgggagactaa

KEGG   Manis javanica (Malayan pangolin): 108410304
Entry
108410304         CDS       T06054                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1 isoform X1
  KO
K05132  interferon gamma receptor 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04066  HIF-1 signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108410304 (IFNGR1)
   04066 HIF-1 signaling pathway
    108410304 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108410304 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108410304 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108410304 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    108410304 (IFNGR1)
   04659 Th17 cell differentiation
    108410304 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108410304 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108410304 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108410304 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108410304 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108410304 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    108410304 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    108410304 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108410304 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108410304 (IFNGR1)
   05140 Leishmaniasis
    108410304 (IFNGR1)
   05142 Chagas disease
    108410304 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108410304 (IFNGR1)
   04090 CD molecules [BR:mjv04090]
    108410304 (IFNGR1)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IFN receptor family
   108410304 (IFNGR1)
CD molecules [BR:mjv04090]
 Proteins
  108410304 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 108410304
NCBI-ProteinID: XP_017536790
LinkDB
Position
Unknown
AA seq 478 aa
MAPLLFLVFILQAGSKAEMSTADPELSSVPKPTSVTIEAYNLNAVLLWEYPLMPLVPVFT
VQVKTYRDAVWIDACNQTIHHYCNISYIINDPSSPLWARVKARLGQKESAYAMSKEFILC
QQGRIGPPKLGIRKKQDQIIIDIFHPLAVINGKEPEAIYDEENNCHMFMYNVYVRINGSD
TTDRTYIQKEDDCNETQCHLSIPVSPLNSKYCISAEGVSDIWAVTTEKSKEICVTIIDEN
RIEDSIWIPVVAALVLFLVLTLPFVYCLIKKINPFSRGSIMLPKSLLSVVKNASSETKSE
SKYISPITYQPIVPENEKVIWEEQLSAATISGVHTEDNPGEGEHTEELSSETEVVTTEEN
TSDMSASGSPLPPEMREDCTHSSSDQSEPCSTAVNAYHSRNGSDSGLVESDSFLSDSEVS
SSNKTEIKTEGQESITLRNTTTSFGYDKPHVLVDLLVDEGVKDTLIGYRPTADSKEFS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcgcccctcctcttcctcgtcttcatcttgcaggccgggagcaaggctgagatgagc
accgcggacccggagctgtcctcggtgccgaaaccaaccagtgttacaattgaggcctac
aacttgaatgccgttctgttatgggaatacccactcatgccacttgtgcctgtgtttact
gtacaggttaagacctacagagatgcagtatggattgatgcctgcaatcaaacaattcat
cattattgtaatatctcttacataataaatgatccatcaagtcctctctgggccagagtt
aaagctaggcttggacaaaaagaatcagcctatgctatgtccaaagaatttattttgtgc
caacaagggaggattggaccaccgaaactgggtatcagaaagaagcaagaccagatcatt
attgacatatttcatcctttagctgttataaatggaaaagaaccagaagccatatatgat
gaagaaaataattgtcacatgttcatgtacaatgtatatgtgaggataaatggaagtgac
accacagatagaacgtacatacagaaggaagatgattgcaatgagactcagtgccacttg
agtatcccagtgtccccactgaattctaagtactgtatttcagcagaaggagtctcagat
atatgggctgtcacaactgaaaagtccaaagaaatctgtgttaccatcattgatgaaaac
agaatagaagattctatttggattccagttgttgctgctctggtactctttctagtactt
accctgccatttgtatattgtctcattaagaagatcaatccatttagtagaggaagcatc
atgttacccaagtccttgctatctgtggtaaaaaatgcctcatcagagacaaaatctgaa
tcaaaatacatatcacccattacctaccaaccaattgtcccagaaaatgagaaggtgatc
tgggaagagcagttgtctgccgcaacaatttcaggtgtgcacactgaggacaatccagga
gaaggagaacacacagaagaactttctagtgagacagaagtggtgaccactgaagaaaat
acctcagacatgtcagcctctgggagccctctgcccccagaaatgagagaggattgtacc
cattccagtagcgaccagtctgagccctgcagcactgctgtaaatgcgtatcactccaga
aatggttctgatagtggccttgtggaatcggacagcttcttatctgactcagaagtttcc
tcaagtaataaaactgaaataaagacagaaggccaagagtccataacactgagaaacact
accacctcctttggttatgataaaccgcatgttttagtggatctgctggtggatgaaggt
gttaaagataccttgattggctacagacctacagcagattccaaagagttttcataa

KEGG   Manis javanica (Malayan pangolin): 108410305
Entry
108410305         CDS       T06054                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108410305 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108410305 (IL22RA2)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL10/28 receptor family
   108410305 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Cohesin_load
Other DBs
NCBI-GeneID: 108410305
NCBI-ProteinID: XP_017536792
LinkDB
Position
Unknown
AA seq 274 aa
MRILRFLFRSELRLTEGNTGCRTSHTCVSRRGTQAAGPVTLAAMAPGRCFVAFLIDFFLM
GGVETHPVYESLKPQRVYFQSRNFHNILHWQPGRACASNNNIYFVQYKMYGQRQWKNKED
CWGIQEFFCDLTNETSDIWEPYYGRVRTTSAGIHSGWTMTRRFTPWWETKIDPPLMNITQ
VNGSSLVILHAPNLPYRDQKGKNEPMENYYVLVYRVFVINNSLQTEQKVYEGIQRVVEIE
ALVHHKGSCVVADIYQPMLDRRSQRSEERCVEVP
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaggattctgcgtttcctcttccgctcggagctgcgtctcacggaggggaacacaggc
tgccggaccagtcacacttgcgtctcacggaggggaacacaggctgccggaccagtcaca
cttgcagccatggcacctggacgctgctttgtggccttcctcattgatttctttctgatg
ggtggagtagaaactcatccagtctatgagtctctgaagcctcaaagagtatattttcag
tcccgaaattttcacaacattttgcactggcagcctgggagggcttgtgccagcaacaac
aatatctattttgtgcagtataaaatgtatggacagagacaatggaaaaataaagaggac
tgttggggtattcaagaattcttctgcgatcttaccaatgaaacttcagacatatgggaa
ccttattacgggagggtgagaacgacttcggctgggatccattcgggctggaccatgaca
cggcggttcactccctggtgggaaacaaaaatagatcctccactcatgaacataactcaa
gttaatggatcttcattggtgattctccatgctccaaatttaccatatagagaccaaaaa
ggaaaaaatgaaccaatggaaaattactacgtgctggtataccgagtctttgtaattaac
aattcactacaaacggaacaaaaggtatatgagggaattcaaagagttgttgaaattgaa
gccctagtacatcacaagggttcctgtgtggtggctgacatatatcagcccatgttagac
agaagaagtcagagaagtgaagagagatgtgtggaagttccttga

DBGET integrated database retrieval system