KEGG   Manis javanica (Malayan pangolin): 108383567
Entry
108383567         CDS       T06054                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04151  PI3K-Akt signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv04940  Type I diabetes mellitus
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108383567 (IL2)
   04151 PI3K-Akt signaling pathway
    108383567 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108383567 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108383567 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108383567 (IL2)
   04660 T cell receptor signaling pathway
    108383567 (IL2)
   04658 Th1 and Th2 cell differentiation
    108383567 (IL2)
   04659 Th17 cell differentiation
    108383567 (IL2)
   04672 Intestinal immune network for IgA production
    108383567 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108383567 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108383567 (IL2)
   05321 Inflammatory bowel disease
    108383567 (IL2)
   05330 Allograft rejection
    108383567 (IL2)
   05332 Graft-versus-host disease
    108383567 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108383567 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108383567 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108383567 (IL2)
   05162 Measles
    108383567 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108383567 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108383567 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108383567 (IL2)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108383567 (IL2)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Haparin
  Cytokines
   108383567 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 108383567
NCBI-ProteinID: XP_017495639
LinkDB
Position
Unknown
AA seq 154 aa
MYKVQLLSCIALTLALVANSAPTSSSTKETEQQLEQLLLDLRLLLNGVNNYENPKLSRML
TFTFYVPKKATELKHLQCLVEELKPVEGVLHLAQSKNFHLRDIKELMSNINVTVLELKGS
ETSFTCEYDDETENIVEFLNKWITFCQSIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaaggtgcagctcttgtcctgcattgcactaactctcgcgcttgtcgcaaacagt
gcacctacttcaagctctacaaaggaaactgagcaacaactggagcagttactgctagat
ttacggttgcttttgaatggagttaataattatgagaaccccaaactctccaggatgctc
acatttacattttatgtgcccaagaaggccacagaattgaaacatcttcagtgtctagta
gaagaactcaaacctgtggagggagtgctacatttagctcaaagcaaaaactttcacttg
agagatatcaaagaattaatgagcaatatcaacgtaactgttctggaactaaagggctct
gaaacaagtttcacatgtgaatatgatgatgagacagaaaacattgtagaatttctaaac
aaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system