KEGG   Manis javanica (Malayan pangolin): 108383567
Entry
108383567         CDS       T06054                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04151  PI3K-Akt signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv04940  Type I diabetes mellitus
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108383567 (IL2)
   04151 PI3K-Akt signaling pathway
    108383567 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108383567 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108383567 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108383567 (IL2)
   04660 T cell receptor signaling pathway
    108383567 (IL2)
   04658 Th1 and Th2 cell differentiation
    108383567 (IL2)
   04659 Th17 cell differentiation
    108383567 (IL2)
   04672 Intestinal immune network for IgA production
    108383567 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108383567 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108383567 (IL2)
   05321 Inflammatory bowel disease
    108383567 (IL2)
   05330 Allograft rejection
    108383567 (IL2)
   05332 Graft-versus-host disease
    108383567 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108383567 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108383567 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108383567 (IL2)
   05171 Coronavirus disease - COVID-19
    108383567 (IL2)
   05162 Measles
    108383567 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108383567 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108383567 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108383567 (IL2)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108383567 (IL2)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108383567 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 108383567
NCBI-ProteinID: XP_017495639
LinkDB
Position
Unknown
AA seq 154 aa
MYKVQLLSCIALTLALVANSAPTSSSTKETEQQLEQLLLDLRLLLNGVNNYENPKLSRML
TFTFYVPKKATELKHLQCLVEELKPVEGVLHLAQSKNFHLRDIKELMSNINVTVLELKGS
ETSFTCEYDDETENIVEFLNKWITFCQSIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaaggtgcagctcttgtcctgcattgcactaactctcgcgcttgtcgcaaacagt
gcacctacttcaagctctacaaaggaaactgagcaacaactggagcagttactgctagat
ttacggttgcttttgaatggagttaataattatgagaaccccaaactctccaggatgctc
acatttacattttatgtgcccaagaaggccacagaattgaaacatcttcagtgtctagta
gaagaactcaaacctgtggagggagtgctacatttagctcaaagcaaaaactttcacttg
agagatatcaaagaattaatgagcaatatcaacgtaactgttctggaactaaagggctct
gaaacaagtttcacatgtgaatatgatgatgagacagaaaacattgtagaatttctaaac
aaatggattactttttgtcaaagcatcttctcaacactgacttga

KEGG   Manis javanica (Malayan pangolin): 108383569
Entry
108383569         CDS       T06054                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108383569 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108383569 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108383569 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    108383569 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108383569 (IL21)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108383569 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 108383569
NCBI-ProteinID: XP_017495640
LinkDB
Position
Unknown
AA seq 153 aa
MRSSPGNMEKIVICLMFIFLGTVAHKSTFQGQDRFLIRLRQLIDIVDQLKNYVNDLDPDL
LPAPEDVKRHCEQSAFSCFQKVQLKSANTGDSEKTIHILTKQLKRKLPPSNEERRQKHRL
TCPSCDSYEKKPPREFLERLKSLIQKMIHQQLS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaagatagtcatctgcctgatgttcatcttcttg
gggacagtggcccataaatccaccttccaagggcaagatcgcttcttgattagattgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccctgatctt
ctgccagctccagaagatgtaaagagacactgtgagcagtcagccttttcatgttttcag
aaggtccaactgaagtcagcaaatacaggagacagtgaaaagaccatccatatattaact
aaacagttgaagaggaaactacctccctcaaatgaagagagaagacagaaacatagactg
acatgcccttcatgtgattcttatgagaaaaaaccacccagagaattcctagaaagactg
aaatcactaatccaaaagatgattcatcagcaactctcctag

KEGG   Manis javanica (Malayan pangolin): 108384008
Entry
108384008         CDS       T06054                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv03050  Proteasome
mjv04060  Cytokine-cytokine receptor interaction
mjv04066  HIF-1 signaling pathway
mjv04217  Necroptosis
mjv04350  TGF-beta signaling pathway
mjv04380  Osteoclast differentiation
mjv04612  Antigen processing and presentation
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04940  Type I diabetes mellitus
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
mjv05322  Systemic lupus erythematosus
mjv05323  Rheumatoid arthritis
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    108384008 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108384008 (IFNG)
   04630 JAK-STAT signaling pathway
    108384008 (IFNG)
   04066 HIF-1 signaling pathway
    108384008 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108384008 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108384008 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108384008 (IFNG)
   04612 Antigen processing and presentation
    108384008 (IFNG)
   04660 T cell receptor signaling pathway
    108384008 (IFNG)
   04658 Th1 and Th2 cell differentiation
    108384008 (IFNG)
   04659 Th17 cell differentiation
    108384008 (IFNG)
   04657 IL-17 signaling pathway
    108384008 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108384008 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108384008 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108384008 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108384008 (IFNG)
   05323 Rheumatoid arthritis
    108384008 (IFNG)
   05321 Inflammatory bowel disease
    108384008 (IFNG)
   05330 Allograft rejection
    108384008 (IFNG)
   05332 Graft-versus-host disease
    108384008 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108384008 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108384008 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108384008 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108384008 (IFNG)
   05164 Influenza A
    108384008 (IFNG)
   05168 Herpes simplex virus 1 infection
    108384008 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108384008 (IFNG)
   05144 Malaria
    108384008 (IFNG)
   05145 Toxoplasmosis
    108384008 (IFNG)
   05140 Leishmaniasis
    108384008 (IFNG)
   05142 Chagas disease
    108384008 (IFNG)
   05143 African trypanosomiasis
    108384008 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mjv03051]
    108384008 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108384008 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108384008 (IFNG)
Proteasome [BR:mjv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108384008 (IFNG)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108384008 (IFNG)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108384008 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5
Other DBs
NCBI-GeneID: 108384008
NCBI-ProteinID: XP_017496291
LinkDB
Position
Unknown
AA seq 166 aa
MNYTSYILVFQLCLILGSPSYYCQATFFTEIENLKEYFNANSPDVADGRPLFLDILKNWK
EENDKKIIQSQIVSFYFKLFESLKDNQVVQKSMDVIKEDMFVKFFNSSTSKLDDFQKLIH
IPVNDLKVQRKAISELIKVMNDLSPRSNLRKRKRSQSPFPGWRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaagttatatcttagtttttcagctctgcctgattttgggttctcctagc
tactactgccaggccacattttttacagaaatagaaaacctaaaggaatattttaatgca
aatagtccagatgtagcagatggaaggcctcttttcttagatattttgaagaattggaaa
gaggagaatgacaaaaaaataattcagagccaaattgtctccttctacttcaaactcttt
gaaagcttaaaagataaccaggtggttcaaaagagcatggatgtcatcaaggaagacatg
tttgttaagttcttcaacagcagcaccagcaagctggatgacttccaaaagctgattcac
attccggtaaatgacctgaaggtccagcgcaaagcaatcagtgaactcatcaaggtgatg
aatgatctgtcaccaagatccaacctaaggaagcggaaaaggagtcagagtccattccca
ggctggagagcgtcaaaataa

KEGG   Manis javanica (Malayan pangolin): 108385428
Entry
108385428         CDS       T06054                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385428
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108385428
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108385428
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108385428
SSDB
Motif
Pfam: PRF CNTF LIF_OSM IL11
Other DBs
NCBI-GeneID: 108385428
NCBI-ProteinID: XP_017498364
LinkDB
Position
Unknown
AA seq 199 aa
SAPLCLLTLLLPPLSPGAPISPAEPINQAYSLALYMQKNTSTLLQTYLQYQGSPFSDPGF
SALELQLSSLPPAAISFKTWHALDDGERLSHAQGAFLALTQHLQLVGDDQRDLNPGSPIL
LAQLGAARLRAQGLLGNMATIMTALGLPVPPEEDTLGLVPFGASAFERKCRGYIVTREYG
HWTDRAVRDLALLKVKYPG
NT seq 600 nt   +upstreamnt  +downstreamnt
tcagcccccctctgcctgctgacccttctgctgccacccctcagtccaggggcccccatc
tccccagctgagcctatcaatcaagcctacagcctggccctctacatgcagaagaataca
tctacactgctccagacttacctccagtaccagggcagcccctttagtgaccctggcttc
tcagcccttgagctccagctcagcagcctgcctcctgctgccatctccttcaagacctgg
catgccttggatgatggggagcggctgagccatgctcagggggccttcctggccttgacc
cagcacctacagcttgtgggggacgaccagagagatctgaaccctggcagtcctatcctg
ctggctcagcttggggctgcaagactcagggcccaaggtctactgggcaacatggctacc
atcatgactgctctgggcctgcccgtcccccctgaagaggacactcttgggcttgtgccc
tttggggcctcagccttcgagaggaaatgtcgaggctatatagtgacccgggaatatggc
cactggacagaccgagctgtgagggacttggctttgctcaaggtcaaataccctggatag

KEGG   Manis javanica (Malayan pangolin): 108385437
Entry
108385437         CDS       T06054                                 

Gene name
CTF1
Definition
(RefSeq) LOW QUALITY PROTEIN: cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385437 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108385437 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108385437 (CTF1)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108385437 (CTF1)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 108385437
NCBI-ProteinID: XP_017498375
LinkDB
Position
Unknown
AA seq 174 aa
MSLREGSLEDPQADSSISSVPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQHQGDPFGLPG
FAPPRLPVAGLSAPASGHASLPAQERLRLDAAALAELSPLXALQARALGAAVEDVLSAQG
SETRGPRPEPAAAPAATAGVFPAKVLGLRVCGLYRDWVSRTEGDLGQLVPGGPG
NT seq 525 nt   +upstreamnt  +downstreamnt
atgagcctaagggagggaagtctggaagacccacaggctgactcttcaatctcatctgtt
ccccacctggaggccaagatccgtcaaacacacagtcttgcccacctccttaccaaatat
gctgagcagctgctccaggaatatgtgcagcaccagggagaccccttcgggctgccaggc
ttcgcgccaccgcggttgccggtagccggcctgagcgccccggcatcgggccacgcgagc
ctgccggcgcaggagcggctgcggcttgacgccgcggcgctggctgagctgtcgccgctg
ngcgcgctccaggcccgggccctaggcgccgcagttgaggacgtgctgtccgcgcagggc
tccgagacccgagggccccggcccgagcccgccgctgctccagccgccaccgccggcgtg
ttcccggccaaggtgctcgggctccgcgtgtgcggcctctaccgcgactgggtgagccga
accgagggcgacctgggccagctggtgcccgggggcccaggctga

KEGG   Manis javanica (Malayan pangolin): 108385980
Entry
108385980         CDS       T06054                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 isoform X1
  KO
K05433  interleukin 15
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04668  TNF signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385980 (IL15)
   04668 TNF signaling pathway
    108385980 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108385980 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    108385980 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385980 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108385980 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108385980 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108385980 (IL15)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108385980 (IL15)
SSDB
Motif
Pfam: IL15 DUF5321
Other DBs
NCBI-GeneID: 108385980
NCBI-ProteinID: XP_017499082
LinkDB
Position
Unknown
AA seq 162 aa
MRISKPYLRSSSIQCYLCLLLNSHFLTEAGIHVFILGCISAGLPKTEAQWQDVISDLKRI
DSLIQSMHIDATLYTESDAHPNCKVTAMKCFLLELHVILRESRNPGIDETVENLIILANN
SLSSSGNVTELGCKECEELEEKNIKEFLRSFVHIVQMFINPS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccatatctgagaagttcttccatccagtgctacttgtgtttactt
ctgaacagtcattttttaacggaggctggcattcatgtcttcattttgggctgtatcagc
gcaggtcttcctaaaacagaggcacaatggcaggatgtaataagtgatttgaaaagaatt
gacagtctcattcaatctatgcatattgatgccactttatatactgaaagtgatgctcat
cccaattgcaaagttacagcaatgaagtgctttctcctggagttacacgttattttgcgt
gagtccagaaatccgggcattgatgaaacagttgaaaacctcatcattctagcaaacaac
agtttatcttccagtgggaatgtaactgaattaggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttacggagttttgtacatatagtgcaaatgttcatcaac
ccttcttga

KEGG   Manis javanica (Malayan pangolin): 108388277
Entry
108388277         CDS       T06054                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108388277
   04151 PI3K-Akt signaling pathway
    108388277
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108388277
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108388277
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108388277
   04621 NOD-like receptor signaling pathway
    108388277
   04622 RIG-I-like receptor signaling pathway
    108388277
   04623 Cytosolic DNA-sensing pathway
    108388277
   04650 Natural killer cell mediated cytotoxicity
    108388277
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388277
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108388277
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108388277
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108388277
   05161 Hepatitis B
    108388277
   05160 Hepatitis C
    108388277
   05171 Coronavirus disease - COVID-19
    108388277
   05164 Influenza A
    108388277
   05162 Measles
    108388277
   05168 Herpes simplex virus 1 infection
    108388277
   05163 Human cytomegalovirus infection
    108388277
   05167 Kaposi sarcoma-associated herpesvirus infection
    108388277
   05169 Epstein-Barr virus infection
    108388277
   05165 Human papillomavirus infection
    108388277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108388277
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108388277
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108388277
NCBI-ProteinID: XP_017502214
LinkDB
Position
Unknown
AA seq 171 aa
SVAQIYLLVAGVMLCCIPTCSPGSVLPWYHSLENRELFKLLQQLKSIPSQSCLNDRTDFK
FPWKRGTITQIRMTQGICFHHQILQQIFNLFSTKESHAVWNNALLHKILFSLDHSLEQLQ
HREEENLACPHLEIVVCKYFQGINLHLKEKEYSPCAWEVVRREIKMCLSLI
NT seq 516 nt   +upstreamnt  +downstreamnt
tctgtggcccagatctatttgctcgtggccggagtgatgctctgctgcatccctacctgc
tctcctggctcggtcttgccttggtaccatagcctagaaaacagggaactcttcaaactt
ctgcaacaactgaaaagtattccctctcagtcctgcctaaatgacagaaccgacttcaaa
ttcccttggaaaagagggactatcactcaaatacggatgacacaaggcatttgcttccac
catcagatactccagcagatcttcaacctcttcagcacaaaggaaagccatgccgtttgg
aacaacgctcttctccataaaatactcttcagccttgatcacagcctggaacaactgcag
cacagggaagaagaaaatctggcctgtcctcacttggaaattgttgtctgcaaatatttc
caaggaatcaatctccatctgaaggaaaaagaatacagcccttgtgcctgggaggttgtc
agaagggaaattaaaatgtgcctttctctcatttga

KEGG   Manis javanica (Malayan pangolin): 108388693
Entry
108388693         CDS       T06054                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108388693 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108388693 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108388693 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    108388693 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108388693 (IL11)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108388693 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 108388693
NCBI-ProteinID: XP_017502695
LinkDB
Position
Unknown
AA seq 204 aa
MEKAGREGVCCLILAALSLWPDRAAAPGPPPGPPRTSPDPRAELDSTVLLTRSLLADTRQ
LAAQLRDKFPADGDHSLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAS
GPSLRILEPELGALQARLDRLLRRLQLLMSRLALPQVPPDPPAPPLAPPTSAWGGIRAAH
AILGGLHLTLDWAVRGLLLLKTRL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaaaaggcaggcagggagggtgtttgctgcctgatcctggccgcactgagcctgtgg
ccagatagagctgctgccccagggccgccaccgggcccgcctcgaacctccccagaccct
cgggctgagctggacagcaccgtgctcctgacccgttccctcctggccgacactcggcag
ctggctgcacagctgagagacaaattcccagctgacggggaccacagcctggactccctt
cccaccttggccatgagtgcaggggcactgggggctctgcagctcccaggtgtgctgacc
agacttcgggcagacctgctctcgtatctgaggcacgttcagtggcttcgtcgggcaagt
ggcccttctctgcggatcctggagccggagctgggagctctgcaggcccggctggaccga
ctgctgcgccggctacagctcctgatgtcccgcctggctctgccccaggtgcccccagac
cctccagctccaccactggcccccccaacctcagcctggggaggcatcagggcagcccac
gccattctcggggggctgcacctgacgctcgactgggctgtgcggggcttgctgctgctg
aagactcggctgtga

KEGG   Manis javanica (Malayan pangolin): 108390063
Entry
108390063         CDS       T06054                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04664  Fc epsilon RI signaling pathway
mjv05200  Pathways in cancer
mjv05310  Asthma
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390063 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390063 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108390063 (IL13)
   04657 IL-17 signaling pathway
    108390063 (IL13)
   04664 Fc epsilon RI signaling pathway
    108390063 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390063 (IL13)
  09163 Immune disease
   05310 Asthma
    108390063 (IL13)
   05321 Inflammatory bowel disease
    108390063 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108390063 (IL13)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108390063 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 108390063
NCBI-ProteinID: XP_017504170
LinkDB
Position
Unknown
AA seq 130 aa
MALWLTVVIALTCLGGLATPGPVPHSRALKELIEELVNITRNQASLCNGSMVWEVNMTAG
KYCAALDSLTNVSDCSAIGKTQRLLKLLCPVKASPVDSSEPIRDTKVEVTQLIKDLLKHL
REIFRHGELN
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcactctggttgaccgtggtcattgccctcacctgccttggtggcctcgccaccccg
ggccccgtgcctcactccagagccctcaaggagctcattgaggagctagtcaacatcacc
aggaaccaggcatccctctgcaacggcagcatggtgtgggaagttaacatgacagccggc
aagtactgtgcagccctggactccctgaccaacgtctctgactgcagtgccatcggaaag
acccagaggctattgaaattactctgccctgtcaaggcctcacctgtggattccagtgag
cctatccgagacaccaaagttgaagtgacccagctgataaaagacctgctcaagcattta
agggaaatctttcgccatggagaactcaactga

KEGG   Manis javanica (Malayan pangolin): 108390065
Entry
108390065         CDS       T06054                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05140  Leishmaniasis
mjv05200  Pathways in cancer
mjv05310  Asthma
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390065 (IL4)
   04151 PI3K-Akt signaling pathway
    108390065 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390065 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108390065 (IL4)
   04660 T cell receptor signaling pathway
    108390065 (IL4)
   04658 Th1 and Th2 cell differentiation
    108390065 (IL4)
   04659 Th17 cell differentiation
    108390065 (IL4)
   04657 IL-17 signaling pathway
    108390065 (IL4)
   04664 Fc epsilon RI signaling pathway
    108390065 (IL4)
   04672 Intestinal immune network for IgA production
    108390065 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390065 (IL4)
  09163 Immune disease
   05310 Asthma
    108390065 (IL4)
   05320 Autoimmune thyroid disease
    108390065 (IL4)
   05321 Inflammatory bowel disease
    108390065 (IL4)
   05330 Allograft rejection
    108390065 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108390065 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108390065 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108390065 (IL4)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108390065 (IL4)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108390065 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 108390065
NCBI-ProteinID: XP_017504172
LinkDB
Position
Unknown
AA seq 134 aa
MGLTSQLIPTLVCFLAFTSNFIHGHKRGVALLEIIRTLNILTARNDPCMELTIQDTFAAP
KNTTEKETFCRAANALRQFYKEHKCWRRLLSGLDRNLSSTANTTFCPMKEAKKSTLKDFL
ERLKMNMKRKYSKY
NT seq 405 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaaccctggtctgctttctagcattcaccagcaac
ttcatccacggacacaagaggggtgttgccttactggagatcatcagaacgctgaacatc
ctcacagcgagaaacgatccatgcatggagctgactatacaggacaccttcgctgcccca
aagaacacaactgagaaggaaaccttctgcagggctgcaaatgcgcttcggcagttctat
aaagagcacaagtgctggcgcagacttttgagcggacttgacaggaacctcagcagcacg
gcaaacacgaccttctgtcctatgaaggaggccaagaagagcacattgaaagacttcctg
gaaaggctaaagatgaacatgaaaaggaaatactcaaagtattga

KEGG   Manis javanica (Malayan pangolin): 108391238
Entry
108391238         CDS       T06054                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv05310  Asthma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391238 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108391238 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108391238 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108391238 (IL9)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108391238 (IL9)
SSDB
Other DBs
NCBI-GeneID: 108391238
NCBI-ProteinID: XP_017506243
LinkDB
Position
Unknown
AA seq 141 aa
MLLAAVLASALLVHSTASQGCMTLTGIKNVKFLINKAQEDAPSKCSCSANVTDCLCLPIP
SDNCTAPCFQEGLWRMTNTTVASPRILILNQVKKTVEALKNNKCQYFSCEEPCSQATAGN
TLTFLKSLLENLQKERMRGRV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcctggctgcagtccttgcctctgccctgcttgtccactccacggccagccagggc
tgtatgaccttgacagggatcaagaatgtcaagttcctcatcaacaaagcgcaggaagat
gcaccttcaaaatgcagctgcagtgccaatgtgactgattgcttgtgcctccccattcct
tctgacaactgcactgcaccctgcttccaggagggcctgtggcggatgaccaacaccact
gtagcaagtcccagaatcctgatcttgaatcaggtgaagaaaacagtggaagccctaaag
aacaacaagtgtcagtatttttcctgtgaagagccatgcagccaagccacagcaggcaac
acactgacatttctgaagagtctcctggaaaatctccagaaagaaaggatgagaggcaga
gtatga

KEGG   Manis javanica (Malayan pangolin): 108391987
Entry
108391987         CDS       T06054                                 

Definition
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391987
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108391987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108391987
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108391987
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 108391987
NCBI-ProteinID: XP_017507387
LinkDB
Position
Unknown
AA seq 191 aa
MATAWVLVLVTVVLGLARAGPVPTSKPTTTRRGCHIGRFQSLSPRELEAFKKAKDALEES
LLLKNWNCSSRLFPRTRDLRHLQAWERPVALEAEVGLTVKVLGTMADSPLGVVLDQPLHM
LRHIHSELQACVPAQPTVRSRPQGRFHHWLRRLQEAPKKESRGCLEASVTFNLLRLLTRD
LKCVASGHLRI
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctacagcttgggttctggtgctggtgaccgtggtgctgggcttggccagagcaggc
cctgtccccacttccaaacccaccaccaccaggaggggctgccacataggcaggttccaa
tctctgtcgccgcgcgaactggaagccttcaagaaggccaaggatgccttggaagagtca
ctcttgctgaagaactggaactgcagctctcgcctcttccccaggaccagggacctgaga
cacctgcaggcgtgggagcgccctgtggccttggaggctgaagtaggcttgacagtgaag
gtcctggggaccatggcagactcacccttaggggtggtcctggaccagccgcttcacatg
ctgcgtcacatccactctgagctccaggcttgtgtcccggctcaacccacagtaagatcc
aggcctcagggtcgcttccaccactggctgcgccggctccaggaggccccgaagaaggag
tcccgaggctgcctggaggcctctgtcacgttcaacctcctccgcctcctcactcgggac
ctaaaatgtgttgccagtggacacctgcgcatctga

KEGG   Manis javanica (Malayan pangolin): 108392856
Entry
108392856         CDS       T06054                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04664  Fc epsilon RI signaling pathway
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05221  Acute myeloid leukemia
mjv05310  Asthma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108392856
   04151 PI3K-Akt signaling pathway
    108392856
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392856
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108392856
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108392856
   04664 Fc epsilon RI signaling pathway
    108392856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108392856
   05202 Transcriptional misregulation in cancer
    108392856
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108392856
  09163 Immune disease
   05310 Asthma
    108392856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108392856
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108392856
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108392856
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108392856
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 108392856
NCBI-ProteinID: XP_017508838
LinkDB
Position
Unknown
AA seq 141 aa
MSSLPILHFLLLLLRLQVPQAQGFPTLRPDQYSVIVTEILRALNKSPLASQNPLNWNDKL
ILRNRALLRPNLDAFLDAASNLYGNDSQIRKNLKEFRPILPTPTTEADQIRIEESNKGDF
QRKLKQYLVTINSFLRDRNRH
NT seq 426 nt   +upstreamnt  +downstreamnt
atgagcagcctccccattctgcactttctcttgctcctgctcagactccaagtccctcag
gcacagggcttcccgacactccggcctgaccagtactctgtgatagtcactgagattctg
agagccctcaacaagtcacctttggcttcacaaaaccccttgaactggaatgacaaattg
atcctgcggaacagggcccttctgaggccaaacctggatgcatttctggacgctgccagt
aatttgtatgggaacgactcacaaatcaggaaaaatctgaaggaattccggcctatcctg
cccacccccacgactgaggcagaccaaatccgtatcgaggagagtaacaagggtgatttc
cagcgtaaattgaagcagtatctggtaaccattaatagtttcctgcgtgacaggaacagg
cattga

KEGG   Manis javanica (Malayan pangolin): 108392857
Entry
108392857         CDS       T06054                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04650  Natural killer cell mediated cytotoxicity
mjv04657  IL-17 signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv05146  Amoebiasis
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05171  Coronavirus disease - COVID-19
mjv05202  Transcriptional misregulation in cancer
mjv05221  Acute myeloid leukemia
mjv05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108392857 (CSF2)
   04668 TNF signaling pathway
    108392857 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392857 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108392857 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    108392857 (CSF2)
   04660 T cell receptor signaling pathway
    108392857 (CSF2)
   04657 IL-17 signaling pathway
    108392857 (CSF2)
   04664 Fc epsilon RI signaling pathway
    108392857 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108392857 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108392857 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108392857 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108392857 (CSF2)
   05171 Coronavirus disease - COVID-19
    108392857 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108392857 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108392857 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mjv03019]
    108392857 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108392857 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108392857 (CSF2)
Messenger RNA biogenesis [BR:mjv03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     108392857 (CSF2)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108392857 (CSF2)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108392857 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 108392857
NCBI-ProteinID: XP_017508839
LinkDB
Position
Unknown
AA seq 144 aa
MWLQNLILLGTVVCSISAPTRTPSPVTRPWQHVNAIKEALSLLNKSGGTDAAMNGTVKVI
SDMFDPQEPTCLQTRLELYKQGLQGGLKTLAGPLTVMASHYKQHCPPTQETSCATQIITF
QSFKQNLKDFLFIIPFDCWEPVRR
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgattctcttgggcactgtggtctgcagcatttcagcgcccacc
cgcacacccagccctgtcacccggccctggcaacatgtgaatgccatcaaggaggccctg
agccttctgaacaagagcggtggtactgatgctgcaatgaatggaacagtaaaagtcatc
tctgacatgtttgacccccaggagccgacatgcctgcagacccgcctggagctgtacaag
cagggcctgcagggcggactcaagaccctcgcaggccccttgaccgtcatggccagccac
tacaagcagcactgtccccccactcaggaaacttcctgtgcaacccagattatcaccttc
caaagtttcaaacagaacctgaaggattttctatttatcatcccctttgactgctgggag
ccagtccggaggtga

KEGG   Manis javanica (Malayan pangolin): 108394700
Entry
108394700         CDS       T06054                                 

Definition
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108394700
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108394700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108394700
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108394700
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 108394700
NCBI-ProteinID: XP_017511902
LinkDB
Position
Unknown
AA seq 189 aa
MAALWVLVLVTAELGLTRASPVPTSKPATTRSGCNFSRFKSLSPRELAAFKKAKDAWENS
LENWNCSSRLFPRTRDLKQLQVWERPIALEAELALTLKVLGTMADSSLGDILDQPLHTLR
HIHSELWACILAQPTAGARPRGRLHHWLRRLQEAPEKESQGCREASVMFNLFRLLKKDLE
CVASRDLCV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctgcactgtgggtcctggtgctggtgactgcggagctgggcttgaccagagctagc
cctgttcccacttccaagcctgccacaaccaggagcggctgcaactttagcaggttcaaa
tctctgtcaccaagggagctagcggccttcaagaaagccaaggatgcctgggaaaattca
ctggaaaactggaactgcagctcccgcctcttccccaggacccgggacctgaaacagctg
caggtgtgggagcgccccattgccttggaggctgagctggccctgacgctgaaggtcctg
gggaccatggctgactcgtccctgggtgacatcctggaccagccacttcacacactgcgc
cacatccactcggagctctgggcctgtatcctagctcagcccacagcaggcgcccggccc
cggggccgcctccaccactggctgcgccggctccaggaggctccagagaaggagtctcaa
ggctgccgcgaggcctctgttatgttcaacctcttccgcctcctcaaaaaggacctggaa
tgtgttgccagcagagacctgtgtgtctaa

KEGG   Manis javanica (Malayan pangolin): 108396861
Entry
108396861         CDS       T06054                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396861 (LIF)
   04668 TNF signaling pathway
    108396861 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108396861 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108396861 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108396861 (LIF)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108396861 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 108396861
NCBI-ProteinID: XP_017515395
LinkDB
Position
Unknown
AA seq 158 aa
MNQIRNQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPAFHANGTEKARLLE
LYRIVAYLGASLGNITRDQKVLNPNALGLHSKLNATADIMRGLLSNVLCRLCSKYHVAHV
DVAYGPDTSGKDVFQKKKLGCQLLGKYKQVIAVVAQAF
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaaccagatcaggaaccagctggcgcagctcaatggcagtgccaatgccctctttatt
ctctattacaccgctcagggggagccattccccaacaacttggacaagctgtgtggcccc
aacgtgacagacttccctgccttccacgccaacggcacggagaaggcccggctgctggag
ctgtaccgcattgtcgcgtaccttggcgcttccctgggcaatatcacgcgggaccagaag
gtcctcaatcccaatgccctcggcctccatagcaagctgaacgccacagcggacatcatg
cggggcctcctcagcaatgtgctctgccgtctgtgcagcaagtaccacgtggcccatgtg
gatgtggcctatggccctgacacctccggcaaggacgtcttccagaagaagaagctgggc
tgtcagctcctggggaagtataagcaggtcatcgctgtggtggcccaggccttctag

KEGG   Manis javanica (Malayan pangolin): 108396879
Entry
108396879         CDS       T06054                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396879 (OSM)
   04151 PI3K-Akt signaling pathway
    108396879 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108396879 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108396879 (OSM)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108396879 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 108396879
NCBI-ProteinID: XP_017515426
LinkDB
Position
Unknown
AA seq 238 aa
MRAQFTRRALLSQVLGLLFLSTAALGSCSDKYQELLGQLRNQADFMQHTNTLLDPYIRVQ
GLDVSGLKEHCKGHPGAFPSEDALRRLSRQGFLRTLNVILSHVLHRLTTLQQELPKAQDL
EMLDRVKLNIRGFRNNLHCMAQLLPSSSDTAEPPQAGPGASPPPTPATDAFQRKLEGCRF
LHGYHGFMHSVQQVLQGWEESPNRSRRHSPRWALWKRVRRMRPSRRDKRLMPRGQLPR
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcgggcacagtttactcggagggcgctgctcagtcaggtccttgggcttctgttcctg
agcacagcggccctgggcagctgctcggacaagtaccaagagctcctcgggcagctccgg
aatcaggcggacttcatgcagcacaccaacacgctcctggacccctatatccgtgtgcaa
ggcctggatgtgagcgggctgaaagagcactgcaaggggcaccctggggccttccccagc
gaggatgccctgcggaggctcagcaggcagggcttcctgaggaccctcaacgtcatcctg
agccatgtcctgcacagactgaccacgttacagcaggagctccccaaagcccaggacttg
gagatgctggatagggtgaagctgaacatccgcggcttcagaaacaacctccactgcatg
gcccagctgctccccagctcctccgacacggctgagcccccgcaggcaggcccgggggcc
tcaccaccacccaccccggccacagatgccttccagcgcaagctggaaggctgcaggttc
ctgcatggctaccacggcttcatgcactccgtgcaacaggtcttgcaagggtgggaggag
agcccgaacaggagccggagacacagcccccgctgggctctgtggaagagggtccgcagg
atgcgaccttccaggagggacaaaagactcatgcccagggggcagttgcctcggtag

KEGG   Manis javanica (Malayan pangolin): 108397407
Entry
108397407         CDS       T06054                                 

Definition
(RefSeq) interferon omega-2-like
  KO
K05440  interferon omega
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04622  RIG-I-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108397407
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108397407
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108397407
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108397407
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108397407
SSDB
Motif
Pfam: Interferon Syntaxin-6_N
Other DBs
NCBI-GeneID: 108397407
NCBI-ProteinID: XP_017516305
LinkDB
Position
Unknown
AA seq 145 aa
MALLLPLLTALVVSSYGPGGSLGCDLPQDHVLVSRKNFVLLGRMRTSAAWNTTLLDRLCT
GLHWQLEDLDSCLEQVMGEEKSALGTEGPALAVKRYFQEIHLYLKEKKYSDCAWEIVRGE
IMRSFSSSRNLQVRIGLKDGDLGYS
NT seq 438 nt   +upstreamnt  +downstreamnt
atggccctcctgctccctctactgacagctctggtggtgtccagctatggccccggcgga
tctctgggctgtgacctgcctcaggaccacgtgctggttagcaggaaaaacttcgtgctt
ctgggccggatgaggacctctgctgcctggaacaccaccctcctggaccgactctgcact
ggactccattggcagctggaagacctggacagctgtttggagcaggtgatgggagaggag
aaatctgccctgggaactgagggccctgcactggctgtgaagaggtacttccaggaaatc
cacctctacctgaaagagaagaaatacagtgactgtgcctgggaaatcgtcagaggggaa
atcatgagatccttctcttcatccagaaatttgcaagtaaggataggacttaaggatgga
gacctgggatattcttaa

KEGG   Manis javanica (Malayan pangolin): 108397408
Entry
108397408         CDS       T06054                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04622  RIG-I-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108397408
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108397408
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108397408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108397408
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108397408
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108397408
NCBI-ProteinID: XP_017516306
LinkDB
Position
Unknown
AA seq 202 aa
MAFLVSSLTVLVMIFSRPISSISCDLPHSLGSGRQETFTALDQMGTISLLSCLKYRTDFK
FPQKELDGSQFQEAQAISVLHEMLQQIFSLFHTERSSAAWNTTLLDRLCTGLHRQLEDLD
TCLVQAMGEEKSALGTEGPALAVKRYFREIHLYLKEKKYSDCAWEIVRVEIKSCFLFINK
LIRKLKKIGGNVTGAFWLKLIL
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgtttctggtctcttcactgacggtgttagtgatgatcttctccaggcccatttcc
tccattagctgtgacctgcctcatagccttggctcgggaaggcaggagaccttcacagct
ctggaccaaatggggacaatctctcttctttcttgtctgaagtataggactgacttcaaa
ttcccccagaaggagctggatggcagccagttccaggaggcccaggccatctctgtcctc
cacgagatgctccagcagatcttcagcctcttccacacagagcgctcctctgctgcctgg
aacaccaccctcctggaccgactctgcactggactccatcggcagctggaagacctggac
acctgtttggtgcaggcgatgggagaggagaaatctgccctgggaactgagggccctgca
ctggctgtgaagaggtatttccgggaaatccacctctacctgaaagagaagaaatacagt
gactgtgcctgggaaattgtcagagtagaaatcaagagctgctttctcttcattaacaag
cttataagaaaactcaagaaaattggaggaaatgtaactggtgccttttggctaaaactt
atattataa

KEGG   Manis javanica (Malayan pangolin): 108397409
Entry
108397409         CDS       T06054                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108397409
   04151 PI3K-Akt signaling pathway
    108397409
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108397409
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108397409
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108397409
   04621 NOD-like receptor signaling pathway
    108397409
   04622 RIG-I-like receptor signaling pathway
    108397409
   04623 Cytosolic DNA-sensing pathway
    108397409
   04650 Natural killer cell mediated cytotoxicity
    108397409
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397409
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108397409
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108397409
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108397409
   05161 Hepatitis B
    108397409
   05160 Hepatitis C
    108397409
   05171 Coronavirus disease - COVID-19
    108397409
   05164 Influenza A
    108397409
   05162 Measles
    108397409
   05168 Herpes simplex virus 1 infection
    108397409
   05163 Human cytomegalovirus infection
    108397409
   05167 Kaposi sarcoma-associated herpesvirus infection
    108397409
   05169 Epstein-Barr virus infection
    108397409
   05165 Human papillomavirus infection
    108397409
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108397409
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108397409
SSDB
Motif
Pfam: Interferon YjcQ MnmE_helical
Other DBs
NCBI-GeneID: 108397409
NCBI-ProteinID: XP_017516308
LinkDB
Position
Unknown
AA seq 185 aa
MALPISVLLALVMLCSSPTGSLGCDLSPSQGSLETFTLLSQMERISILSCLKDRTDFRFP
QVLVDGNQLEKTQTIAVVHEMLQQIFNLFITSGSSVALEETFLDKFLTGLYQQLSELETC
LEEEKEVEHSLLGSENSRLIVKRYFQGISLYLKGKEYSRCAWEVVRVEIRRCLLFIKKIT
GKLRK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctcccaatttctgtactgctggccctggtgatgctgtgctccagccccactggc
tctctgggttgtgatctgtctccaagccaaggcagtctggaaacgttcacacttttgagt
cagatggagagaatctccattctgtcttgtctgaaggacaggactgatttcagatttcct
caggtgcttgtggatgggaaccagttggagaagacacagaccatagcggtcgtgcatgag
atgcttcagcagatcttcaacctcttcatcacaagtggctcttctgtggctttggaggag
accttcctggacaaattcctcactggactttatcagcagctgagtgagctggagacatgt
ttggaggaggaaaaggaggtggaacactcactcctgggaagtgagaactccagactgatt
gtgaagaggtacttccaaggaatcagtttgtatctgaaagggaaagaatacagccgctgt
gcctgggaggttgtcagggtggaaatcagaaggtgcttactcttcattaagaagatcaca
ggaaaactcaggaaataa

KEGG   Manis javanica (Malayan pangolin): 108398622
Entry
108398622         CDS       T06054                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01523  Antifolate resistance
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04218  Cellular senescence
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04657  IL-17 signaling pathway
mjv04659  Th17 cell differentiation
mjv04668  TNF signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05010  Alzheimer disease
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05321  Inflammatory bowel disease
mjv05323  Rheumatoid arthritis
mjv05332  Graft-versus-host disease
mjv05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108398622 (IL6)
   04668 TNF signaling pathway
    108398622 (IL6)
   04066 HIF-1 signaling pathway
    108398622 (IL6)
   04068 FoxO signaling pathway
    108398622 (IL6)
   04151 PI3K-Akt signaling pathway
    108398622 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398622 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108398622 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108398622 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108398622 (IL6)
   04620 Toll-like receptor signaling pathway
    108398622 (IL6)
   04621 NOD-like receptor signaling pathway
    108398622 (IL6)
   04623 Cytosolic DNA-sensing pathway
    108398622 (IL6)
   04625 C-type lectin receptor signaling pathway
    108398622 (IL6)
   04659 Th17 cell differentiation
    108398622 (IL6)
   04657 IL-17 signaling pathway
    108398622 (IL6)
   04672 Intestinal immune network for IgA production
    108398622 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398622 (IL6)
   05202 Transcriptional misregulation in cancer
    108398622 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108398622 (IL6)
   05321 Inflammatory bowel disease
    108398622 (IL6)
   05332 Graft-versus-host disease
    108398622 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108398622 (IL6)
   05020 Prion disease
    108398622 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    108398622 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108398622 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108398622 (IL6)
   04931 Insulin resistance
    108398622 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108398622 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108398622 (IL6)
   05135 Yersinia infection
    108398622 (IL6)
   05133 Pertussis
    108398622 (IL6)
   05134 Legionellosis
    108398622 (IL6)
   05152 Tuberculosis
    108398622 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108398622 (IL6)
   05161 Hepatitis B
    108398622 (IL6)
   05171 Coronavirus disease - COVID-19
    108398622 (IL6)
   05164 Influenza A
    108398622 (IL6)
   05162 Measles
    108398622 (IL6)
   05168 Herpes simplex virus 1 infection
    108398622 (IL6)
   05163 Human cytomegalovirus infection
    108398622 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108398622 (IL6)
   05169 Epstein-Barr virus infection
    108398622 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108398622 (IL6)
   05144 Malaria
    108398622 (IL6)
   05142 Chagas disease
    108398622 (IL6)
   05143 African trypanosomiasis
    108398622 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108398622 (IL6)
   01523 Antifolate resistance
    108398622 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108398622 (IL6)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108398622 (IL6)
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 108398622
NCBI-ProteinID: XP_017518213
LinkDB
Position
Unknown
AA seq 206 aa
MNSLFTSAFPPAFLSLGLLLVMATGFVTPAPAGGVTSNKPSLTTPGNVEQRVKYMLSKIS
ELRKELCSKFDKCNDQDAVSANNMHLPKLEERDGCFQSGYNQDICALRFTSGLLEYEIYL
EYVQSSYDGDEDKAKNLEGSIKALVQALQEKMKNFNLVCIPSPSAREGLLFKLKSQAQWL
KNSTIYLIMRGFEDFLEVGIRAVRNY
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaactccctcttcacaagtgccttcccgccagcgttcctctcactggggctgctcctg
gtgatggctactggcttcgttaccccagcacctgcaggtggtgtcacctcaaataagcca
tcactcaccactccaggaaacgtggaacagcgtgtgaaatacatgctctctaaaatcagt
gaactgagaaaggagctgtgtagcaagtttgacaagtgtaacgaccaggacgcagtttca
gcaaacaacatgcaccttccaaaactggaagagagagatggatgcttccaatctgggtac
aatcaggatatctgtgcactaagatttaccagtggtcttctggagtatgagatctacctg
gagtatgtccagagcagttatgatggtgatgaggacaaggccaagaatttggagggcagc
atcaaagccctggtccaggccctacaggaaaagatgaaaaatttcaatttagtatgcatc
cctagcccatcagcaagagaaggcctgttgtttaagctgaagtcacaggctcagtggctg
aagaactcgaccatttacttgatcatgaggggctttgaagacttcctggaggtcggcata
cgggctgttcgtaactattaa

KEGG   Manis javanica (Malayan pangolin): 108398928
Entry
108398928         CDS       T06054                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7 isoform X1
  KO
K05431  interleukin 7
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108398928 (IL7)
   04151 PI3K-Akt signaling pathway
    108398928 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398928 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108398928 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398928 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108398928 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108398928 (IL7)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108398928 (IL7)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108398928 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 108398928
NCBI-ProteinID: XP_017518810
LinkDB
Position
Unknown
AA seq 174 aa
MFHVSSRYVFGIPPLILVLLPVASFDCDIKGKDGREYRNVLKISIEDLDSMIKTHSNCLN
NESSFFKRHACDDNKEATFLYHAARKLKQFKMNASEDFDIHLSRVSQGTLKLLNCSNKEG
RKPPSLGEVQPSKKLEGNKSSKEQKRQNYMCFLKILLQKIKSCWNKILRDAKEH
NT seq 525 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttctaggtatgtctttggaattcctcccctgatccttgttttgttg
ccagtagcctcatttgattgtgatattaaaggtaaagacggcagagaatatcggaatgtt
ctaaagatcagcattgaggacttggacagcatgataaaaactcatagcaattgcctgaat
aacgaatctagcttttttaaaagacatgcatgtgatgataataaggaagctacattttta
tatcatgctgctcgcaagttgaagcaatttaaaatgaatgccagtgaggatttcgatatc
cacttatcacgagtttcacagggcacattaaaactgttgaactgctcgaacaaggaagga
agaaaaccaccttctctgggtgaagtccaacccagtaagaaattagaagggaataaatct
tcaaaggaacagaaaagacagaattacatgtgtttcctaaagatactactacaaaagata
aaatcttgttggaataaaattttgagggacgctaaagaacattaa

KEGG   Manis javanica (Malayan pangolin): 108399095
Entry
108399095         CDS       T06054                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04622  RIG-I-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108399095 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108399095 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108399095 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108399095 (IFNK)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108399095 (IFNK)
SSDB
Motif
Pfam: Interferon IFP_35_N Tsi6
Other DBs
NCBI-GeneID: 108399095
NCBI-ProteinID: XP_017519149
LinkDB
Position
Unknown
AA seq 208 aa
MSTKSDMIRKCWWFVCFVGLFITGNLSLDCNLLNVHLSRVTWQNLRLLSSMSNTFPAECL
REKKAFELPQEILSHNRPVKRDIMEVFYEIYIQAFNIFNQYNFTSTWEEKHVKQIQIGLD
EQLQYLEQCLEEEEKENEDMHEMGENKMKYSGAMVPQLSNLELRRYFHRIDNFLKDKKYS
HCAWEIVRVEIRRCFYYFVKFTELLGRK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagcaccaaaagtgatatgattcggaagtgctggtggtttgtatgctttgtgggtctg
ttcatcactggcaacctctctctggattgtaacttgctgaatgttcacctgagtagagtc
acctggcaaaatctcagacttctgagcagtatgagcaatacatttcctgcagaatgtcta
agagaaaagaaagcttttgagttgccccaagagatcctatcacacaaccggcctgtgaaa
agggacatcatggaggtcttctatgaaatatacatacaagccttcaacatcttcaatcaa
tacaacttcacatccacttgggaagagaaacatgtgaaacaaatccaaatcggacttgat
gagcagttgcagtacctggaacaatgcttggaagaagaggagaaggaaaatgaagacatg
catgagatgggagagaataagatgaaatactcaggagctatggttccccagctgagcaac
ctagaactgaggagatactttcacaggatagataattttctgaaagataagaaatacagt
cactgtgcctgggagatcgttcgagtggaaatcagaagatgtttctactactttgtgaaa
ttcacagaactactcgggaggaaataa

KEGG   Manis javanica (Malayan pangolin): 108402233
Entry
108402233         CDS       T06054                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05133  Pertussis
mjv05152  Tuberculosis
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
mjv05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108402233 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108402233 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108402233 (IL23A)
   04659 Th17 cell differentiation
    108402233 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108402233 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108402233 (IL23A)
   05321 Inflammatory bowel disease
    108402233 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108402233 (IL23A)
   05152 Tuberculosis
    108402233 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108402233 (IL23A)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108402233 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 108402233
NCBI-ProteinID: XP_017524098
LinkDB
Position
Unknown
AA seq 189 aa
MGILGSRALLLALLVWPAQGQTVPEHSRPAWDQCQQLSQKLCTLAWSAHPPMGHVELPRE
GDDETTNEAPHIQCADGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPTLLPDG
PVGQLQASLLGLRQLLQPEGHHWETERTPSPSASQPWQRLLLRLKILRSLQAFIAAATRV
FAHGATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atggggatcctggggagtagagccctgctgctggcgctgctggtctggcccgcgcagggc
cagactgtgcctgagcatagtcgccccgcctgggatcagtgccagcagctctcccagaag
ctctgcacactggcctggagtgcacacccaccaatgggacacgtggaactaccaagagaa
ggagatgatgagactacaaatgaggcccctcatatccagtgtgcggacggctgtgatccc
caaggactcagggacaacagccagtcctgcttgcaaaggatccaccagggcctggtcttt
tacgagaagttgctgggctcagacattttcacaggggagcctactctactccctgatggc
ccagtaggccagcttcaggcttccttactaggcctcaggcaactcttgcagccagagggt
caccactgggaaactgagcggactccaagccccagtgccagccagccgtggcagcgcctc
cttctccgcctcaagatccttcgcagcctgcaggcctttatagctgcagccacccgggtc
tttgcccatggagcaactctgagcccctaa

KEGG   Manis javanica (Malayan pangolin): 108402531
Entry
108402531         CDS       T06054                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04668  TNF signaling pathway
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108402531 (IFNB1)
   04668 TNF signaling pathway
    108402531 (IFNB1)
   04151 PI3K-Akt signaling pathway
    108402531 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108402531 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108402531 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108402531 (IFNB1)
   04621 NOD-like receptor signaling pathway
    108402531 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    108402531 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    108402531 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    108402531 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108402531 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108402531 (IFNB1)
   05152 Tuberculosis
    108402531 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108402531 (IFNB1)
   05161 Hepatitis B
    108402531 (IFNB1)
   05160 Hepatitis C
    108402531 (IFNB1)
   05171 Coronavirus disease - COVID-19
    108402531 (IFNB1)
   05164 Influenza A
    108402531 (IFNB1)
   05162 Measles
    108402531 (IFNB1)
   05168 Herpes simplex virus 1 infection
    108402531 (IFNB1)
   05163 Human cytomegalovirus infection
    108402531 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108402531 (IFNB1)
   05169 Epstein-Barr virus infection
    108402531 (IFNB1)
   05165 Human papillomavirus infection
    108402531 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108402531 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108402531 (IFNB1)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108402531 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108402531
NCBI-ProteinID: XP_017524625
LinkDB
Position
Unknown
AA seq 185 aa
MTNRYILPVALLLYFSTTALSGSYNLLRFQLRSSSLVCVELLRQLNGSPQYCLKDRMNFE
APEEIERSQQFQKEDAVLVIHEMLQQIFGIFRRNFSRTGWNETVVENLLSELYVQMNHLE
TILEESTEEENFWENMTIVHLKRYYLRLVRYLKAKEYSRCAWTVVQVEVLRNFSFLDSLT
NYLLN
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccaacaggtatatcctcccagtcgctctcctgttgtatttctccactacagctctt
tctgggagctacaacttgcttcgattccaactaagaagcagcagtttggtgtgtgtggag
ctcctgcggcagttgaatggaagccctcaatattgcctcaaggacaggatgaacttcgag
gcccctgaggagattgagcgatcacagcagttccagaaggaggacgccgtcctggtcatc
cacgagatgctccagcagatctttggtatcttcagaagaaatttctcaagaactggatgg
aatgagaccgtggttgagaacctccttagtgaactctatgtgcagatgaaccatctggag
acaatcctggaggaatccacagaggaggaaaacttctgggaaaacatgaccatcgtgcac
ctgaagagatactacttacggctcgtgcggtacctgaaggcaaaggagtacagcaggtgt
gcctggacagtagtccaggtggaggtcctcaggaacttttccttccttgatagccttaca
aattacctcctaaactga

KEGG   Manis javanica (Malayan pangolin): 108403017
Entry
108403017         CDS       T06054                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04068  FoxO signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05150  Staphylococcus aureus infection
mjv05152  Tuberculosis
mjv05310  Asthma
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05322  Systemic lupus erythematosus
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403017 (IL10)
   04068 FoxO signaling pathway
    108403017 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403017 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108403017 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108403017 (IL10)
   04660 T cell receptor signaling pathway
    108403017 (IL10)
   04672 Intestinal immune network for IgA production
    108403017 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108403017 (IL10)
   05322 Systemic lupus erythematosus
    108403017 (IL10)
   05320 Autoimmune thyroid disease
    108403017 (IL10)
   05321 Inflammatory bowel disease
    108403017 (IL10)
   05330 Allograft rejection
    108403017 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108403017 (IL10)
   05133 Pertussis
    108403017 (IL10)
   05150 Staphylococcus aureus infection
    108403017 (IL10)
   05152 Tuberculosis
    108403017 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108403017 (IL10)
   05144 Malaria
    108403017 (IL10)
   05145 Toxoplasmosis
    108403017 (IL10)
   05140 Leishmaniasis
    108403017 (IL10)
   05142 Chagas disease
    108403017 (IL10)
   05143 African trypanosomiasis
    108403017 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403017 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108403017 (IL10)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403017 (IL10)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108403017 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 108403017
NCBI-ProteinID: XP_017525384
LinkDB
Position
Unknown
AA seq 178 aa
MPDSVLLCCLVLLAGVGASLNQDAPPENSCTHFPASLPHMLRELRAAFSKVKAFFQMKDQ
LDDMLLSSSLLEDFKGYLGCQALSEMIQFYLKEVMPLAENHSPDISEHVNSLGEKLKTLR
LRLRRCHRFLPCENRSKAVEQVKTAFSKLQEKGVYKAMSEFDIFINYIEAYMTMRMEN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccgactcagtgctgctatgttgcctggtcctcttggctggggtgggagccagccta
aaccaggatgccccacctgagaacagctgcacccactttccagccagcctgccccacatg
ctccgagagctccgagctgccttcagcaaggtgaaggctttctttcagatgaaggaccag
ctggacgacatgctgttgagcagttccttgctggaggactttaagggttacctcggttgc
caagccttgtcagagatgatccagttttacctgaaggaagtgatgcccctggctgagaac
cacagcccagacatcagcgagcacgtgaactccctgggggaaaagctgaagactctcagg
ctgaggctgcgacgctgtcatcgatttctgccctgcgagaacaggagcaaggccgtggag
caggtgaagaccgccttcagtaagctccaagagaaaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgagaatggaaaactga

KEGG   Manis javanica (Malayan pangolin): 108403018
Entry
108403018         CDS       T06054                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403018 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403018 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108403018 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403018 (IL19)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403018 (IL19)
SSDB
Motif
Pfam: IL10 U62_UL91
Other DBs
NCBI-GeneID: 108403018
NCBI-ProteinID: XP_017525385
LinkDB
Position
Unknown
AA seq 176 aa
MKARCASLCLSAALILCSVHARSLGRCLISVDMRLIEESFREIKKDMQAKDTFQNVTILS
TSETLHGIKPLDVCCVTKNLLAFYVDRVFKDHQELNPQILRKISSIANSFLYMQKTLQQC
QEQRLCRCRPEVTNATRIIHDNYNQLEVRSAAIKSLGELDVFLAWIDKNHQGSSAD
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaggcccggtgtgcttccctctgtctgagtgcagcgcttatcctgtgctcggtgcac
gcccgaagtctcgggagatgtctgatttccgtggacatgcgccttatagaagagagtttc
agagaaatcaaaaaagacatgcaagctaaggacaccttccaaaatgtcaccatattgtcc
acatcggagaccctgcatggcattaagccgttggacgtgtgctgtgtgacaaagaacctc
ctggcgttttacgtggacagggtgttcaaggaccatcaggagctgaaccctcaaatcttg
agaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcaacagtgt
caggagcaaaggctgtgtcgctgcaggccggaagtcaccaatgccaccagaatcatccat
gacaactacaatcagctggaggtccgatccgctgcaattaagtctctgggagagctggac
gtctttctagcctggattgacaagaaccatcaaggatcttcagctgactga

KEGG   Manis javanica (Malayan pangolin): 108403020
Entry
108403020         CDS       T06054                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403020 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403020 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108403020 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403020 (IL24)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403020 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 108403020
NCBI-ProteinID: XP_017525388
LinkDB
Position
Unknown
AA seq 183 aa
MNSSVRMAAIPCLGLILFLWSQGPGVQGQEFQFGPCRVEGVVLQELWEAFRATKDIVQAQ
DNVKSVRLLQKEVLQNVSDAESCHLIHALLKFYLDAVFKNYPSKAAESKILKSFSTLTNN
FIVIVSKLQPSQKNEMFSTSKSARRRFLRFQRAFKKLDIEAARIKAFGEVDILLAWMERF
YRL
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaactcctcagtgcggatggctgccatcccctgcctgggtctgatcctgtttctctgg
agccaagggccaggggtccaaggccaagaattccaattcgggccctgccgagtagagggg
gtcgttctccaggaactgtgggaggccttccgggccacaaaagacatcgtgcaagctcag
gataacgtcaagagcgtccggctgctgcagaaagaggttctacagaacgtctcggatgct
gaaagctgtcacctcatccatgcactgctgaagttctacttggacgccgtcttcaaaaac
taccccagtaaggcagctgaatccaagatcctgaagtccttctctactctgaccaacaac
ttcattgtcatcgtgtcaaaactacaacccagtcagaaaaatgagatgttctctaccagc
aagagtgcacgcaggcggtttctgcggttccagcgagcatttaaaaagttggacatagaa
gcggctcggatcaaagcctttggagaagtggacattctcttggcctggatggagagattc
taccggctctga

KEGG   Manis javanica (Malayan pangolin): 108403021
Entry
108403021         CDS       T06054                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04061  Viral protein interaction with cytokine and cytokine receptor
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403021 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403021 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    108403021 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403021 (IL20)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403021 (IL20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 108403021
NCBI-ProteinID: XP_017525389
LinkDB
Position
Unknown
AA seq 202 aa
MKCPGLPFCLLSAVFYLFWTPSAGLKTLHLGSCVITANLQEMRNGFSGIRDSAQAEDEII
DIRILRKTESLQNTKPAGQCCVLRHILRLYLDRIFKYYQTPDHHILRKISGLANSFLMIK
KDLRLCHAHMTCPCGDEAMEKYSQILSHFEELTPHAAAVKALGELDILLQWMEEMESEEV
RNNDAAQGIPGQGSQTSVPAEA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaatgccctggtcttcccttctgccttctctctgctgtgttttacctcttctggaca
ccttcggctgggctaaagacactccatttgggaagctgtgtgatcaccgcaaaccttcag
gaaatgcgaaatggcttttctgggatacgagacagtgcgcaagccgaagatgaaatcatt
gacatcagaatcttgaggaagaccgagtctttgcagaatacaaagcctgcaggtcagtgc
tgcgtcctccgccacatactgagactctacctggacaggatattcaaatactatcagacc
cctgaccaccatatccttcggaagatcagcggtcttgccaactcttttcttatgatcaag
aaggacctccggctctgtcatgcccatatgacatgcccttgcggggatgaagcaatggag
aaatacagccagattctgagtcacttcgaagagcttacgcctcacgcagccgcggtgaag
gctttgggggagctagacattctcctgcagtggatggaggagatggaatcagaggaagta
cggaataatgacgctgctcagggtatccctggccaagggtcccagacctccgtacctgca
gaagcatga

KEGG   Manis javanica (Malayan pangolin): 108403291
Entry
108403291         CDS       T06054                                 

Gene name
IL17D
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-17D
  KO
K05492  interleukin 17D
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04657  IL-17 signaling pathway
mjv04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403291 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403291 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108403291 (IL17D)
   04659 Th17 cell differentiation
    108403291 (IL17D)
   04657 IL-17 signaling pathway
    108403291 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403291 (IL17D)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403291 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 108403291
NCBI-ProteinID: XP_017525820
LinkDB
Position
Unknown
AA seq 142 aa
MESDIVTDRVMPRGRPADRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAYCLCRGCLT
GLFGEEDFHFRSTPVYMPTAILRRTSACAGGRSVYTEEYVTIPVGAPASPSRRXCTCVPE
PEKEANSVNSSMDKRGAKPGRP
NT seq 429 nt   +upstreamnt  +downstreamnt
atggagtccgacattgtaacagaccgagtgatgcccaggggcaggccagccgaccggcgc
ttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagaatttcctacgac
cctgccaggtaccccaagtacctgcctgaggcctactgcctgtgcaggggctgcctgacc
gggctgttcggggaggaggattttcacttccgcagcaccccggtgtacatgcccaccgcc
atcctccggaggacctccgcctgcgccgggggccgctccgtgtacacagaggagtacgtc
accatccccgtgggcgcacctgcgtccccgagccggagaanctgcacctgcgtccccgag
ccggagaaggaagccaacagtgtcaactccagcatggacaagcggggtgccaagcccggc
cggccctga

KEGG   Manis javanica (Malayan pangolin): 108404046
Entry
108404046         CDS       T06054                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5 isoform X1
  KO
K05428  interleukin 5
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05200  Pathways in cancer
mjv05310  Asthma
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108404046 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108404046 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108404046 (IL5)
   04660 T cell receptor signaling pathway
    108404046 (IL5)
   04658 Th1 and Th2 cell differentiation
    108404046 (IL5)
   04657 IL-17 signaling pathway
    108404046 (IL5)
   04664 Fc epsilon RI signaling pathway
    108404046 (IL5)
   04672 Intestinal immune network for IgA production
    108404046 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404046 (IL5)
  09163 Immune disease
   05310 Asthma
    108404046 (IL5)
   05320 Autoimmune thyroid disease
    108404046 (IL5)
   05321 Inflammatory bowel disease
    108404046 (IL5)
   05330 Allograft rejection
    108404046 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108404046 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108404046 (IL5)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108404046 (IL5)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108404046 (IL5)
SSDB
Motif
Pfam: IL5 CmlA_N
Other DBs
NCBI-GeneID: 108404046
NCBI-ProteinID: XP_017526961
LinkDB
Position
Unknown
AA seq 134 aa
MRMLLHLYFLTFAAASICAIAGESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHQNH
QLCIDEVFRGIDTLKNQTAQGDAVEKLFQNLSLIKEYIELQKNKCGGERWRVKQFLDYLQ
VFLGVINTEWITES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgtattttctaacttttgcagcagcctctatttgtgctatt
gcaggagaaagtcccatgaatagactggtggcagaaaccttgacgttgctctctactcat
cgaactctgcttataggcgacgggaatctgatgatccctactcctgaacatcaaaatcac
caactgtgcattgatgaagtgtttcggggaatagacacactgaagaatcaaactgcacaa
ggagatgctgtggaaaaattattccaaaacttgtctttaataaaagaatacattgagctc
caaaaaaacaagtgtggaggagaaagatggagagtaaaacaattcctagactacctgcaa
gtgttcctcggagtaataaatactgagtggataacggaaagttga

KEGG   Manis javanica (Malayan pangolin): 108406572
Entry
108406572         CDS       T06054                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108406572 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108406572 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108406572 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    108406572 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108406572 (IL22)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108406572 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 108406572
NCBI-ProteinID: XP_017530824
LinkDB
Position
Unknown
AA seq 179 aa
MAALQKTVSSSFMGPLAASCLLLIALWVQGGAAVPISSHCSLDKSNFQQPYITNRTFMLA
NEASLADNNTDVRLIGEKLFSRVNMRERCYLMKQVLNFTLEEVLLPQSDRFQPLMQEVVP
FLARLSNKLRHCHIAGDDQHIKRNVQKLKDTVKKLGESGEIKAIGELDLLFMALRNYCI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaaactgtgagctcttcctttatggggcctctggctgccagctgc
ttgcttctcattgccctctgggtacagggtggagcagctgtgcccatcagttctcactgt
agtcttgacaagtccaacttccagcaaccttatatcacgaaccgcaccttcatgctggct
aacgaggctagtttggcagataacaacacagatgtccgtctcattggggagaaactgttc
agcagagtcaatatgagagagcgctgttatctgatgaagcaggtgctcaactttaccctt
gaagaagtgctgctcccccagtctgacagattccagcccctgatgcaggaggtggtgcct
ttcctggccaggctcagcaacaagctcaggcattgtcatattgccggtgatgatcagcat
ataaagagaaatgtgcaaaagctgaaggacacagtgaagaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctctttatggccttgagaaattactgcatttga

KEGG   Manis javanica (Malayan pangolin): 108407980
Entry
108407980         CDS       T06054                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108407980 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108407980 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108407980 (TSLP)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108407980 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 108407980
NCBI-ProteinID: XP_017533167
LinkDB
Position
Unknown
AA seq 143 aa
MVFFRKIFILQLVGLVLTYNFTDCDFEKIKKRYHYVIYPALKEYMNGTKSTKFNSISCKD
PPDCLTKIEQINFNPTHGCPSLPKEIFAVRTNATLILQCPGYYGIQINTQAMKERKNREV
TTNKCLEQVSYLIYLWHRFSRIS
NT seq 432 nt   +upstreamnt  +downstreamnt
atggtttttttcaggaagatcttcatcttgcaattggtagggctcgtgctaacctacaat
ttcactgactgtgactttgagaagattaaaaaaaggtatcactatgtcatttatccagcc
ctgaaggaatatatgaatgggaccaagagtacaaagttcaactccatctcctgtaaagac
ccgccggattgcctcactaaaatagaacaaattaacttcaaccccacgcacggctgtccg
tcacttcccaaggaaattttcgcagtaagaactaatgctacgctcattctccagtgccca
ggctactacggaattcagataaatactcaggcaatgaaggaaagaaagaacagagaagtc
acaacaaacaaatgcctggaacaagtctcatacttaatatatttgtggcatcgtttcagt
cgcatttcttag

KEGG   Manis javanica (Malayan pangolin): 108408539
Entry
108408539         CDS       T06054                                 

Definition
(RefSeq) interferon omega-2-like
  KO
K05440  interferon omega
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04622  RIG-I-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108408539
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108408539
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108408539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108408539
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108408539
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108408539
NCBI-ProteinID: XP_017534143
LinkDB
Position
Unknown
AA seq 188 aa
MLDRMSSENLGSQAHPDAQLRQASSTLASPMALLLPLLTALVVSSYGPGGSLGCDLPQDH
VLVSRKNFVLLGRMRRISPFLCLFHTERSSAAWNTTLLDRLCTGLHQQLEDLDTCLVQAM
GEEKSALGTEGPALAVKRYFREIHLYLKEKKYSDCAWEIVRGEIMRSFSSSRKLQVRMGL
KDGDVGSA
NT seq 567 nt   +upstreamnt  +downstreamnt
atgcttgacagaatgtcctcagaaaacctagggtcccaggctcacccagacgcccagctg
aggcaggccagcagcaccctcgcctcccccatggccctcctgctccctctactgacggct
ctggtggtatccagctatggccccggcggatctctgggctgtgacctgcctcaggaccac
gtgctggttagtaggaaaaacttcgtgcttctgggccggatgaggagaatctcccctttc
ctctgcctcttccacacagagcgctcctctgctgcctggaacaccaccctcctggaccga
ctctgcactggactccatcagcagctggaagacctggacacctgtttggtgcaggcgatg
ggagaggagaaatctgccctgggaactgagggccctgcactggctgtgaagaggtatttc
cgggaaatccacctctacctgaaagagaagaaatacagtgactgtgcctgggaaattgtc
agaggggaaatcatgagatccttctcttcatccagaaagttgcaagtaaggatgggactt
aaggatggagacgtgggatctgcttaa

KEGG   Manis javanica (Malayan pangolin): 108408540
Entry
108408540         CDS       T06054                                 

Gene name
IFNE
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon epsilon
  KO
K05442  interferon epsilon
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04622  RIG-I-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108408540 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108408540 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108408540 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108408540 (IFNE)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108408540 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108408540
NCBI-ProteinID: XP_017534144
LinkDB
Position
Unknown
AA seq 213 aa
MINKPFFEIVLVLLASTTVFSLELKLVLFQQRVNRESLKLLNKLKTPSIQQCLSHRKIFL
LPHQYQDPPVSFLNPHXYQKGHTITIFXEMLQQILNLFRTSMPLDSWGESHVENLINELH
PQLVYLEAFMGLEAEQKGGTLGSENLRLQVKMYFXWIHDYLENQEYSSCAWTIVRVDXCL
SFVFQLTGKLSKRGVXSWNHVEQEPTAGFKSIG
NT seq 642 nt   +upstreamnt  +downstreamnt
atgattaacaagcctttctttgaaattgtcttggtgctgctggcctctaccactgtcttc
tccctggaactgaaactggttctcttccaacaaagagtgaacagagagagtttaaaactc
ttgaataaactgaaaaccccatcaattcagcagtgcctatcgcacaggaaaatcttcctg
cttccccaccaataccaggatcctcctgtatctttcctgaatcctcactagtaccagaaa
ggacacacaataaccatcttcnttgagatgcttcagcagatcctcaacctgttcaggaca
agtatgcctttggacagctggggagaaagccatgtggaaaacttaatcaacgaacttcat
ccacagctggtatacttagaagctttcatgggactggaagcagagcaaaaaggtggcaca
ttgggtagtgaaaaccttagattacaggttaaaatgtacttctaatggatccatgattat
ctggaaaaccaggaatacagcagctgtgcctggaccattgtccgagtagacnagtgtctg
tcctttgtgttccaactcacaggaaagctgagcaaacgaggagtgngatcctggaaccac
gtggagcaggagccaactgcaggctttaaaagcatagggtag

KEGG   Manis javanica (Malayan pangolin): 108409113
Entry
108409113         CDS       T06054                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04620  Toll-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04940  Type I diabetes mellitus
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05162  Measles
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409113 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409113 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108409113 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    108409113 (IL12A)
   04625 C-type lectin receptor signaling pathway
    108409113 (IL12A)
   04658 Th1 and Th2 cell differentiation
    108409113 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409113 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108409113 (IL12A)
   05330 Allograft rejection
    108409113 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108409113 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108409113 (IL12A)
   05134 Legionellosis
    108409113 (IL12A)
   05152 Tuberculosis
    108409113 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108409113 (IL12A)
   05164 Influenza A
    108409113 (IL12A)
   05162 Measles
    108409113 (IL12A)
   05168 Herpes simplex virus 1 infection
    108409113 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108409113 (IL12A)
   05144 Malaria
    108409113 (IL12A)
   05145 Toxoplasmosis
    108409113 (IL12A)
   05140 Leishmaniasis
    108409113 (IL12A)
   05142 Chagas disease
    108409113 (IL12A)
   05143 African trypanosomiasis
    108409113 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108409113 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108409113 (IL12A)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108409113 (IL12A)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108409113 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 108409113
NCBI-ProteinID: XP_017535009
LinkDB
Position
Unknown
AA seq 328 aa
MPEFRFPFGAAGGGGAVPERLRPGSRGVNPKAPQTPRADLHVSLEADVERDREKESKRPK
SRESPVALRGNYKNVTPWAGIPATALPCRARPSASSRRLRAQRPLSMGPARRLLLVAMLA
LLNHLGHPGLARSLPTATPGLGMLQCLSHSQNLLRAVGNMLQKARQTLEFYSCSSEEIDH
EDITKDKTSTVEACLPLELTTNESCLASREISFLTNGSCLASSKASFMMTLCLSSIYEDL
KMYQVEFKAMNAKLLMDPKRQISLDQNMLAAIDELMQALSFNSETVPQKPSLEEPDFYKT
KIKLCILLHAFRIRVVTIDRMMSYLNSS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgccggaatttcgctttccctttggggcagccggaggcggcggggccgtcccggaacgt
ctgcggccaggctcccggggagttaatccgaaagcgccgcaaaccccgcgggccgacctc
cacgtgtcactagaagctgatgtagagagagaccgagagaaagaaagcaagagaccgaag
tcccgggaaagtcctgtcgcgcttcggggcaattataaaaatgtgaccccctgggccggc
atcccagccaccgccctcccctgtcgcgcccgcccgtccgcgtccagccgccggctccgt
gcacagcgcccgctcagcatgggtcccgctcgcaggctcctcctcgtggccatgctggcc
ctcctaaaccacctgggccaccccggtttggccaggagcctccccacagccacaccaggc
ctaggaatgctccagtgcctcagccactcccaaaacctgctgagagccgtcggcaacatg
cttcagaaggccagacaaacccttgaattttactcctgctcttctgaagagattgatcat
gaagatatcacaaaagataaaaccagtacagtggaggcctgcttaccactggaattaacc
acgaatgagagctgcctggcttccagagagatctctttcttaactaatgggagttgtctg
gcctccagtaaggcctcttttatgatgaccctgtgccttagcagtatctatgaagacttg
aagatgtaccaggtggagttcaaggccatgaatgcaaagcttttgatggatcctaagagg
cagatctctctggatcaaaacatgctggcagctattgatgagctgatgcaggccctgagt
ttcaacagtgagactgtgccacaaaaaccctcccttgaagaaccggatttttataaaact
aaaatcaagctctgcatacttcttcatgctttcagaattcgtgtggtgactatcgataga
atgatgagctatctgaattcttcctaa

KEGG   Manis javanica (Malayan pangolin): 108409190
Entry
108409190         CDS       T06054                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04620  Toll-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04940  Type I diabetes mellitus
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05162  Measles
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409190 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409190 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108409190 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    108409190 (IL12B)
   04625 C-type lectin receptor signaling pathway
    108409190 (IL12B)
   04658 Th1 and Th2 cell differentiation
    108409190 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409190 (IL12B)
   05205 Proteoglycans in cancer
    108409190 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108409190 (IL12B)
   05330 Allograft rejection
    108409190 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108409190 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108409190 (IL12B)
   05134 Legionellosis
    108409190 (IL12B)
   05152 Tuberculosis
    108409190 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108409190 (IL12B)
   05164 Influenza A
    108409190 (IL12B)
   05162 Measles
    108409190 (IL12B)
   05168 Herpes simplex virus 1 infection
    108409190 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108409190 (IL12B)
   05145 Toxoplasmosis
    108409190 (IL12B)
   05140 Leishmaniasis
    108409190 (IL12B)
   05142 Chagas disease
    108409190 (IL12B)
   05143 African trypanosomiasis
    108409190 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108409190 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108409190 (IL12B)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108409190 (IL12B)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108409190 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 fn3 Ig_3 Ig_2
Other DBs
NCBI-GeneID: 108409190
NCBI-ProteinID: XP_017535102
LinkDB
Position
Unknown
AA seq 329 aa
MQPPPFAISWFSLVLLASPLGAIWELEKNVYVVEVDWYPDAPGEMVVLTCDTPEEDGITW
TSDQSGDVLGSGKTLTIQVKEFVDAGQYTCHKGGQVLSHSLLLLHKKEDEIWSTDILKDQ
KEPKSKTFLKCEAKNYSGHFICWWLTAISSGLKFSVKSSRGSSDPQGVTCGAVTLSSERV
RVDHREYKKYMVECQESSACPAAEEVLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLKPMTNSRHVEVSWEYPDTWSTPHSYFSLTFCIQVQGKNKRIKKDRLFVDQTLAKVM
CHKDANIHVQARDRYYRSSWSEWASVPCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagcctccaccattcgccatctcctggttttccctggttttgctggcatctcccctt
ggggccatatgggaactggagaaaaatgtttatgttgtagaggtggactggtaccccgat
gcccctggagaaatggtggtcctcacctgtgacacccccgaagaagatggcatcacctgg
acctcagaccagagcggtgacgtcttaggctctggcaaaaccttgaccatccaagtcaaa
gagtttgtcgatgccggccagtacacctgtcacaaaggaggccaggttttgagccattca
ctcctgctgcttcacaaaaaggaagatgaaatttggtccactgatatcttaaaggaccag
aaagaacccaaaagcaagacctttttgaaatgtgaggcaaagaactattccggacatttc
atctgctggtggctgacagccatcagcagtggtttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccaaggggtgacatgtggagcagtgacactctcatcggagagagtc
cgagtggaccacagggagtataagaagtacatggtggagtgtcaggagagcagtgcctgt
ccagctgccgaggaggttctgcccattgaagttgtggtggacgctgttcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggatatcatcaaaccagacccacccaag
aacctgcagctgaagccaatgacaaattctcggcacgtggaggtcagctgggagtaccct
gacacctggagcaccccacattcctacttctccctgacattttgcattcaggtccagggc
aagaacaagagaataaagaaagatagactcttcgtggaccagaccttagccaaggtcatg
tgccacaaggatgccaatatccacgtgcaagcccgtgaccgctactacaggtcatcctgg
agcgaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system