KEGG   Manis javanica (Malayan pangolin): 108383963
Entry
108383963         CDS       T06054                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108383963
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108383963
   00982 Drug metabolism - cytochrome P450
    108383963
   00983 Drug metabolism - other enzymes
    108383963
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108383963
   05204 Chemical carcinogenesis
    108383963
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108383963
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108383963
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108383963
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108383963
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108383963
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108383963
SSDB
Motif
Pfam: GST_C GST_C_3 GST_C_2 CoV_S2
Other DBs
NCBI-GeneID: 108383963
NCBI-ProteinID: XP_017496228
LinkDB
Position
Unknown
AA seq 153 aa
MWGARLXMGRYFLSAAANTAGVNVWVLGSPWQKLFSVXIPSLVTSFVGRRNEKDCSGLKE
EFNKLEEVLTNKKTTFFGGSSLSMTDYLIWPWFEWLEALELNECVDHTPKLKLWMAAMKE
DPTVLALLTNGKALQGFLDLYLQNSPQACDYGL
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtggggcgccagacttgncatggggcgctattttctgagcgcggctgccaacacagct
ggagtcaatgtctgggtcctaggctctccctggcagaagttattttctgtctagatacca
tctttggtaacaagctttgttggaaggagaaatgaaaaagactgctctggcctgaaagaa
gagttcaacaagctagaggaggttctgaccaataagaagacaactttctttggtggcagt
tctctttctatgactgattatctcatctggccctggtttgaatggttggaggctctggag
ttaaacgagtgtgtagaccacactccaaaacttaagctctggatggcagccatgaaggaa
gatcccacagtattggccctcctcaccaatgggaaggccttgcaaggtttcttagatctc
tacttgcagaacagcccccaggcctgtgactatgggctctga

KEGG   Manis javanica (Malayan pangolin): 108387168
Entry
108387168         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108387168
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108387168
   00982 Drug metabolism - cytochrome P450
    108387168
   00983 Drug metabolism - other enzymes
    108387168
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108387168
   05204 Chemical carcinogenesis
    108387168
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108387168
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108387168
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108387168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108387168
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108387168
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108387168
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 108387168
NCBI-ProteinID: XP_017500858
LinkDB
Position
Unknown
AA seq 240 aa
MSLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLRKVPALKDG
DFTLAESVAILLYLSRKYEAPDHWYPQDLQARARVDEYLAWQHTTLRSCCTRAMWQKLMF
PVFLGERVPPKTLASTLAELDRCLQLLEDKFLKDQDFLAGSHISVADLVAITELMHPVSA
GCQVFKSRPKLAAWCQRVEAAVGEDLFQEAHAAVMKAKDLPPADSAVKEKLKPLVQVLLQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagcctggagctgtacctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccctttcgagctgcgcacggtggagctgctcaaaggccagcac
cacagcgatgcctttgcccaggtgaaccccctgaggaaggtgccagccttgaaggacggg
gacttcaccttggctgagagtgtggccatcctgctctacctgagtcgcaagtatgaggcc
cctgaccactggtacccacaggacctccaggcccgtgcccgtgtggatgagtacctggct
tggcagcacacgaccctgcggagttgctgtacccgagccatgtggcagaagctgatgttc
cctgtgttcctgggtgaacgggtgccccccaagaccctggcatctactttggctgagctg
gacaggtgtctgcagctgcttgaggacaaatttctgaaggaccaggacttccttgctggg
tcccacatctcagtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgccaagtcttcaaaagcagacccaaactggctgcatggtgccagcgtgtggaggcc
gcagtgggagaggacctctttcaggaggcccatgcagctgtcatgaaggccaaggacctg
cctccagcagacagtgctgtgaaggagaagctgaagcccttggtacaggttttgttgcag
tga

KEGG   Manis javanica (Malayan pangolin): 108388981
Entry
108388981         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase theta-4-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108388981
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108388981
   00982 Drug metabolism - cytochrome P450
    108388981
   00983 Drug metabolism - other enzymes
    108388981
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388981
   05204 Chemical carcinogenesis
    108388981
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108388981
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108388981
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108388981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108388981
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108388981
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108388981
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 Methyltr_RsmB-F
Other DBs
NCBI-GeneID: 108388981
NCBI-ProteinID: XP_017503035
LinkDB
Position
Unknown
AA seq 130 aa
MKQLSGLPMACASLVLELYGDLLSAPCRAVYIFARKNSIRFEFRSVDVLKGHHHSKEYIQ
INPLRRLPSLKDGTFILSESVAILCYLCWKYSAPSHWYPPELHTRARVDEFMAWQHTAIQ
LPMSKMLWIK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagcagctctccggcctccccatggcgtgtgccagcctggtcctggagctctacggg
gacctgctgtcagcaccctgccgggctgtctacatcttcgccaggaagaacagcatccgc
tttgaattccgatctgtggatgtgttgaagggtcaccaccacagcaaggaatacatccag
atcaaccccctgaggaggctgcccagcctcaaagatggaacgtttatcttatctgaaagc
gtggccatcctttgctacctgtgctggaagtacagcgccccctctcactggtacccgccg
gagctgcacacgcgcgcccgtgtggacgagttcatggcatggcagcacacagccattcag
ctgcccatgagcaagatgctctggatcaag

KEGG   Manis javanica (Malayan pangolin): 108388983
Entry
108388983         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108388983
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108388983
   00982 Drug metabolism - cytochrome P450
    108388983
   00983 Drug metabolism - other enzymes
    108388983
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388983
   05204 Chemical carcinogenesis
    108388983
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108388983
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108388983
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108388983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108388983
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108388983
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108388983
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 108388983
NCBI-ProteinID: XP_017503036
LinkDB
Position
Unknown
AA seq 242 aa
MAPELFLDLYSPPCRAVYIFARKNGIPFALRPVELGRGEHLKPEFLKVNPLGKVPALRDG
DFLLSESVAILLYLSRKYQTAAHWYPPEPQARARVDEYLAWQHAAIQLPAANVYLCKSLL
PYFSGQPVDTTKLEQLLGKLTPSLQHLDQKVLAARPFLASEQLSLADLIAFTDLMQPTAV
GCDVFQDRPRLAAWRARVEAALGPQLVQEAHRLVLQPRDPQLVQQDPQLAQELVQRLQER
LR
NT seq 729 nt   +upstreamnt  +downstreamnt
atggcgccggagctctttctggacctgtactcgcccccctgccgtgccgtctacattttc
gccaggaagaacggcatcccctttgcgctgcggccggtggagctgggacggggggagcac
ctgaagcccgaattcctgaaggtgaaccccctggggaaggtgcccgccctcagggacggg
gacttcctgctgtctgagagtgtggccatccttttatacctgagccgcaagtaccagaca
gcggcccactggtacccacctgaaccgcaggcccgtgcccgtgtggacgagtacctggcg
tggcagcacgctgccatccagctgcctgctgccaacgtctacctgtgtaagtctctcctg
ccctacttctcggggcaacctgtggacaccacaaagctggaacagctgctggggaagctc
actccttcactgcagcacctggatcagaaagtcctggcagccaggcccttcctagcctct
gagcagctctccttggcagacctaatagcattcacggacctgatgcagcccactgctgtc
ggctgcgacgtcttccaagacaggccccgtctggcagcgtggcgggcccgtgtggaggct
gcactgggccctcagcttgtccaggaggctcacaggctcgtgctacagccgcgggacccc
caattggtccagcaggacccccagctggcccaggagttggtgcagcggctgcaggagcgg
ctccgctga

KEGG   Manis javanica (Malayan pangolin): 108389550
Entry
108389550         CDS       T06054                                 

Gene name
GSTT2B
Definition
(RefSeq) glutathione S-transferase theta-2B
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108389550 (GSTT2B)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108389550 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    108389550 (GSTT2B)
   00983 Drug metabolism - other enzymes
    108389550 (GSTT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389550 (GSTT2B)
   05204 Chemical carcinogenesis
    108389550 (GSTT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108389550 (GSTT2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108389550 (GSTT2B)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108389550 (GSTT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108389550 (GSTT2B)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108389550 (GSTT2B)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108389550 (GSTT2B)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 LPD14
Other DBs
NCBI-GeneID: 108389550
NCBI-ProteinID: XP_017503499
LinkDB
Position
Unknown
AA seq 245 aa
MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHLTGALFQKSSSLRRLPTLKD
GDFVLTESVAIMIYLSFKYQTAEHWYPPDLQARARIHEYLGWHADCIRGVFGVPLWTKVL
APLIGVQVPEEKVQHNRIAMDQALQVLQDKFLGDRAFLTGQQVALADLLVLEELMQPVAI
GYDLFEGRPQLTAWRERVETFLGTDLLQEAHSSILNVMERVANKTFLEPLPEAYPFMLLR
ISKIP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacggcatccccttcgagctgcgccctgtggagctgctcaaagggcagcac
ctgaccggggccctcttccagaagagcagcagcctgaggcggctgcccaccctcaaggac
ggcgacttcgtcttgaccgaaagtgtggccattatgatttacctgagctttaagtaccag
acggcggagcactggtacccccctgacctgcaggcccgtgcccgcatccacgagtacctg
ggctggcacgctgactgcatccgtggcgtgtttggtgtgcccctgtggaccaaggtcctg
gcgccactcattggggttcaagtgcctgaggagaaggtgcagcacaacaggatcgccatg
gaccaggcactgcaggtgctgcaggacaagttcctgggggacagggccttcctcaccggc
cagcaggtggcattagctgacctcctggtgctggaggaactgatgcagcccgtggctatt
ggctatgacctgtttgagggacggccacaactgacagcatggcgtgagcgagtggagact
ttcctgggtaccgatctactccaggaggcccacagctctatcttgaacgtcatggaacgt
gtggccaacaaaacattcctggaacccctgccagaagcctatccatttatgctgcttcgt
atttccaagatcccctga

KEGG   Manis javanica (Malayan pangolin): 108389679
Entry
108389679         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase theta-4 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108389679
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108389679
   00982 Drug metabolism - cytochrome P450
    108389679
   00983 Drug metabolism - other enzymes
    108389679
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389679
   05204 Chemical carcinogenesis
    108389679
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108389679
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108389679
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108389679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108389679
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108389679
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108389679
SSDB
Other DBs
NCBI-GeneID: 108389679
NCBI-ProteinID: XP_017503614
LinkDB
Position
Unknown
AA seq 141 aa
MRVGCSLLFPPLPHPGQLLIPKITGEEVPAEKMEEMLIEVTKNVQLFEEKFLQDKMFITA
DYVSLADLVASVEMMQPMGGNHNVFLNSSKLAEWRMRVELAIGSGLFWEAHDRLVKLAEW
DCSTLDPVVKGRICEWLQKYN
NT seq 426 nt   +upstreamnt  +downstreamnt
atgagagtggggtgcagcctcctcttccctcctctcccccaccctgggcagctgctgatc
ccgaagatcacaggtgaggaggttccagccgagaaaatggaggagatgctgatagaggtg
acaaagaacgtgcagctctttgaggagaagtttctgcaggacaagatgttcatcactgcg
gactacgtctcactggctgacctggtggcctcggtggagatgatgcagcccatggggggc
aaccataacgtcttcctcaacagctccaagctggctgagtggcgcatgagggtggagctg
gccattggctctggccttttctgggaggcccatgaccggctggtgaagttggcagagtgg
gactgttccaccctggatccggtagtcaaggggaggatctgcgagtggctacagaagtac
aactag

KEGG   Manis javanica (Malayan pangolin): 108400994
Entry
108400994         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase Mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108400994
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108400994
   00982 Drug metabolism - cytochrome P450
    108400994
   00983 Drug metabolism - other enzymes
    108400994
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400994
   05204 Chemical carcinogenesis
    108400994
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108400994
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108400994
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108400994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108400994
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108400994
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108400994
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 108400994
NCBI-ProteinID: XP_017522139
LinkDB
Position
Unknown
AA seq 218 aa
MAMTLGYWDIRGLAHSIRLLLEYTDSNYEEKKYTMGDAPDYDRSQWLNEKFTLGLDFPNL
PYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRMDILENQVMDTRLHQARVCYSPDF
EKLKLEYLKEIPEKMKLYSQFLGKRPWFAGNKLTYVDFLAYDILEMHRIFEPRCLDAFPN
LKDFIARIEGLKKISAYMKSSRFLHAPVYSKLALWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggccatgaccttgggttactgggatatccgcggactggctcactccatccgcctgctc
ctggagtacacagactcaaactatgaggagaagaagtacacgatgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcacgctgggcctggacttccccaatctg
ccttacttaattgacggggctcacaagatcacccagagcaacgccatcctgcgctacatt
gctcgcaagcacaacctttgtggggaaacagaagaggagaaaattcgcatggacattttg
gagaaccaggttatggacacccgcctgcaccaggccagggtctgttacagccctgacttt
gagaaactgaagcttgaatacttgaaagagatccctgaaaaaatgaagctctactcacag
tttctggggaagaggccttggtttgcagggaacaagctcacctatgtggatttcctggct
tatgacatccttgaaatgcaccgcatatttgagcctaggtgcctggatgctttcccaaac
ctgaaagacttcatagcccgcattgagggcctgaagaagatctctgcttatatgaagtcc
agccgcttcctccatgccccagtgtactcaaaacttgccctgtggggcaataagtag

KEGG   Manis javanica (Malayan pangolin): 108400995
Entry
108400995         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase Mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108400995
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108400995
   00982 Drug metabolism - cytochrome P450
    108400995
   00983 Drug metabolism - other enzymes
    108400995
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400995
   05204 Chemical carcinogenesis
    108400995
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108400995
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108400995
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108400995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108400995
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108400995
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108400995
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_2 GST_C_6
Other DBs
NCBI-GeneID: 108400995
NCBI-ProteinID: XP_017522141
LinkDB
Position
Unknown
AA seq 226 aa
MSSSKSSVVLGYWDIRGLAHAIRLLLEFTDTCYEEKRYTCGEAPDYDRSQWLDVKFKLDL
DFPNLPYLMDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIMENQIMDFRMQLAQLC
YSPDHEKLKPQYLEQLPEQLKQFSLFLGKFSWFAGEKLTFVDFVTYDVLDQNHMFEPKCL
DEFPNLKAFMCRFEALEKIAAYMQSNRFFKMPINNKMAQWGNKRIC
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtcgtcgtccaagtcgtctgtggtgctgggttactgggatattcgcgggctggcgcac
gccatccgcttgctcctggagttcactgatacatgctatgaggagaaacggtacacttgc
ggggaagctcctgactatgatagaagccaatggctggatgtgaaattcaagctagacctg
gacttccctaacctgccctatctcatggatggtaagaacaagatcacccagagcaatgcc
atcttgcgctacatcgctcgcaagcacaatatgtgtggtgagactgaagaagaaaagatt
cgagtcgacataatggaaaaccaaataatggatttccgcatgcagctggcacaactctgc
tacagccctgaccacgaaaaactaaagccgcagtacttggaacagctacctgaacaactg
aaacaattctccttgttcctggggaaattctcatggtttgcaggggaaaagctcaccttt
gtggatttcgtcacctatgatgtcttagatcagaaccatatgtttgagcccaagtgcctg
gatgaatttccaaatctgaaggctttcatgtgccgttttgaggctttggagaaaatagct
gcctacatgcagtctaaccgcttcttcaagatgcccatcaacaacaagatggcccagtgg
ggcaacaagagaatatgctga

KEGG   Manis javanica (Malayan pangolin): 108402719
Entry
108402719         CDS       T06054                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108402719 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108402719 (MGST3)
   00982 Drug metabolism - cytochrome P450
    108402719 (MGST3)
   00983 Drug metabolism - other enzymes
    108402719 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108402719 (MGST3)
   05204 Chemical carcinogenesis
    108402719 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108402719 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108402719 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108402719 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108402719 (MGST3)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108402719 (MGST3)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108402719 (MGST3)
SSDB
Motif
Pfam: MAPEG Bax1-I
Other DBs
NCBI-GeneID: 108402719
NCBI-ProteinID: XP_017524916
LinkDB
Position
Unknown
AA seq 152 aa
MAVLSKEYGFVVLTGAASFILVAHLAINVAKARKKYKVEYPTMYSMDPENGHLFNCIQRA
HQNTLEVYPPFLFFLAIGGVYHPRIASGLGMAWIVGRALYAYGYYTGEPSKRSRGALGSI
ALIGLMGTTVCSAFQHLGWVKTGLGSGSKCCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgtcctctccaaggaatacggtttcgtggttctgacaggcgcggccagcttcata
ctggtggctcacctggccatcaacgtcgccaaggcccgcaagaagtacaaagtggagtat
cctaccatgtacagcatggaccctgaaaatgggcacctcttcaactgcattcagcgagcc
caccagaacacgttggaagtatatccccccttcttattttttctagctattggaggtgtt
taccacccgcgtatagcttctggcttgggcatggcctggattgtgggaagagccctttat
gcatacggctactacacaggagaacccagcaagcggagtcgtggagcgctgggctccatc
gccctcattggcctgatgggcacaactgtgtgctctgccttccagcatcttggctgggtc
aaaactggcttgggcagcgggtccaaatgttgccattaa

KEGG   Manis javanica (Malayan pangolin): 108404356
Entry
108404356         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase A1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108404356
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108404356
   00982 Drug metabolism - cytochrome P450
    108404356
   00983 Drug metabolism - other enzymes
    108404356
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404356
   05204 Chemical carcinogenesis
    108404356
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108404356
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108404356
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108404356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108404356
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108404356
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108404356
SSDB
Motif
Pfam: GST_N GST_N_3 BRCA2
Other DBs
NCBI-GeneID: 108404356
NCBI-ProteinID: XP_017527385
LinkDB
Position
Unknown
AA seq 199 aa
MMVGKPTLHYFNGRGRMESIGWLLAAAGVEFEEKFIETPEDLDKLRNDGSLMFQQVPMVE
IDGMKLVQTRAILNYIATKYNLYGKDIKERAFIDMYAEGIADINEMIMLLPICPLNEKDA
KIALIKEKTTNRYLPVFENVSGLFGIWGTALRGQEPKRALKSRISNLPTVKKFLQPGGQR
KPPVDEKSLEKAKKIFRLK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgatggtggggaagcccacgcttcactacttcaacggacgaggccgaatggagtccatc
gggtggctcctggcggcggcgggagtagagtttgaagagaaatttatagaaactccagaa
gaccttgacaagttaagaaatgatgggagtttgatgttccagcaagtgccaatggttgaa
attgatggaatgaagctggtacagaccagagccattctcaactacattgccaccaaatac
aacctgtatgggaaggacataaaggagagagccttcattgatatgtatgcagaaggtata
gcagatataaatgaaatgatcatgcttttgccaatatgtccactgaatgaaaaagatgcc
aagattgccctgatcaaagagaaaacaacaaatcgctatctccctgtgtttgaaaatgta
agtgggctgtttggcatctggggcactgcgcttagaggacaagaaccaaagcgagccctg
aaaagcagaatcagcaatctccctactgtgaagaagttcctgcagcctggcgggcagagg
aagcctcccgtggatgaaaaaagtttagagaaagcaaagaaaattttcaggttgaaataa

KEGG   Manis javanica (Malayan pangolin): 108404357
Entry
108404357         CDS       T06054                                 

Definition
(RefSeq) glutathione S-transferase A4-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108404357
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108404357
   00982 Drug metabolism - cytochrome P450
    108404357
   00983 Drug metabolism - other enzymes
    108404357
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404357
   05204 Chemical carcinogenesis
    108404357
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108404357
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108404357
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108404357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108404357
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108404357
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108404357
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2 GST_N_2
Other DBs
NCBI-GeneID: 108404357
NCBI-ProteinID: XP_017527386
LinkDB
Position
Unknown
AA seq 222 aa
MAAKPKLCYFRGRGRMESIRWLLAAAGVEFEEEFIETREQYDKLLKDGRLLFGQVPLVEI
DGMALTQTRAILSYLAAKYNLYGKDLKERASIDMYTDGTLDLMMMVALAAFKPPEEKEEN
FALIVKRAKTRYFPVFEKILKDHGENFLVGNKFSWADIQLLEAILMVEELNASVLADFPL
LQAFKTRISNIPTIKKFLQPGSQKKPPPDSHYVQLVRHILKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcggccaaacccaagctctgctatttccgcggcagaggcaggatggagtcgatccgc
tggctgctggctgcagctggagtggagtttgaagaagaatttattgaaacaagagaacaa
tatgacaagttgttgaaggatggacgcctgctctttggccaagtgcctctggttgaaatt
gacggaatggcattgacccagactagagccatcctcagctatcttgctgccaagtacaac
ctgtatgggaaggacctgaaggagagagccagtattgacatgtacaccgatggcaccctg
gacctcatgatgatggtcgctctggctgcgttcaaaccccctgaggaaaaagaggagaac
tttgctttaattgtgaagagagctaaaacccgttacttccccgtctttgaaaagattttg
aaagaccatggagagaattttctcgttggcaacaaattcagttgggcagacatacaactg
ttagaagctattttaatggtggaagaactcaatgcttccgtgcttgctgacttccccctg
ctgcaggcatttaaaacaagaatcagcaacatccctacaattaagaagttcctgcagccg
gggagtcagaagaagccgcccccagatagccactatgtccaactagtcaggcacatcttg
aagttctaa

KEGG   Manis javanica (Malayan pangolin): 108404359
Entry
108404359         CDS       T06054                                 

Gene name
GSTA4
Definition
(RefSeq) glutathione S-transferase A4 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108404359 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108404359 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    108404359 (GSTA4)
   00983 Drug metabolism - other enzymes
    108404359 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404359 (GSTA4)
   05204 Chemical carcinogenesis
    108404359 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108404359 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108404359 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108404359 (GSTA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108404359 (GSTA4)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108404359 (GSTA4)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108404359 (GSTA4)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 GST_N_3 CbeA_antitoxin
Other DBs
NCBI-GeneID: 108404359
NCBI-ProteinID: XP_017527388
LinkDB
Position
Unknown
AA seq 235 aa
MGSFLALESRKAMMAAKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQRLQDG
NHLLFQQVPMVEIDGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEATLDLLELII
MHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKVLRDHGQRFLVGDQLSLADVILLQTILAL
EEKIPNILSAFPHLQEFSVKISNVPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP
NT seq 708 nt   +upstreamnt  +downstreamnt
atggggtcattcttggctctggaaagcagaaaagccatgatggcagcgaagcccaagctc
cactacccgaacgggaggggccggatggaatccgtaagatgggttttagctgccgctgga
gtcgagtttgatgaagaattcttagaaacaaaagaacagctgcagaggttgcaggatggt
aaccacctgctgttccagcaagtgccaatggtcgaaattgatgggatgaagttggtgcag
acgcgaagcatcctccactacatagcggacaagcaccatctctttggcaaggacctcaag
gagagaaccttgattgacatgtacgtggaggcaacactagatctgctggagctgattatc
atgcatcctttcctaaaaccagatgatcaacaaaaggaagtggttaacatggcccagaag
gctatcattaggtacttccctgtgtttgaaaaggttttaagggatcatggacagaggttt
ctcgttggtgatcagctgagccttgcagacgtgattctactccaaaccattttggctcta
gaagagaaaatccctaacatcctgtctgcatttcctcaccttcaggagttttcagtgaaa
ataagtaatgtccctacaattaagaaatttcttgaaccgggcagcaagaagaagccacct
ccagatgacatctatgtgagaaccgtctacaacatctttatgccctaa

KEGG   Manis javanica (Malayan pangolin): 108405833
Entry
108405833         CDS       T06054                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05215  Prostate cancer
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108405833 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108405833 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    108405833 (GSTP1)
   00983 Drug metabolism - other enzymes
    108405833 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108405833 (GSTP1)
   05204 Chemical carcinogenesis
    108405833 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108405833 (GSTP1)
   05215 Prostate cancer
    108405833 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108405833 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108405833 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108405833 (GSTP1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108405833 (GSTP1)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108405833 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 108405833
NCBI-ProteinID: XP_017529666
LinkDB
Position
Unknown
AA seq 191 aa
MLLADQGQSWKEEVVTKETWLQGPLKASCLYGQLPKFQDGDLTLYQSNAILRHLGRTLGL
YGKDQLEAALVDMVNDGVEDLRCKYTTLIYTNYEAGKEDYVKALPGHLKPFETLLSQNQG
GQAFIVGDQISFADYNLLDLLLNHQVLAPGCLDSFPLLSAYVVRLSARPKLKAFLASPEH
VNRPINGNKKQ
NT seq 576 nt   +upstreamnt  +downstreamnt
atgctgctggctgaccagggccagagctggaaggaggaggtggtgaccaaggagacctgg
ctgcagggcccactcaaggcgtcctgtctgtatgggcagctccccaagttccaggacgga
gacctcactctgtaccagtccaatgccatcctgagacacctgggtcgcaccctcgggctg
tatgggaaggaccagctggaggcggccctggtggacatggtgaatgacggcgtggaggac
ctccgctgcaaatacaccaccctcatctacaccaactacgaggcaggcaaggaggactat
gtgaaggcactgccggggcacctgaagccatttgagaccctgctatcccagaaccagggg
ggccaagccttcattgtgggtgaccagatctcctttgcagactacaacctgctggacttg
ctgctgaatcaccaggtcctggcccccggctgcctggactccttccccctgctctcagcc
tatgtggtgcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcac
gtgaaccgccccatcaacggcaacaaaaaacagtga

KEGG   Manis javanica (Malayan pangolin): 108405867
Entry
108405867         CDS       T06054                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108405867 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108405867 (MGST2)
   00982 Drug metabolism - cytochrome P450
    108405867 (MGST2)
   00983 Drug metabolism - other enzymes
    108405867 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108405867 (MGST2)
   05204 Chemical carcinogenesis
    108405867 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108405867 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108405867 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108405867 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108405867 (MGST2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108405867 (MGST2)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108405867 (MGST2)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 108405867
NCBI-ProteinID: XP_017529727
LinkDB
Position
Unknown
AA seq 146 aa
MAGNAILLAAVSVLSACQQSYFALQVGKARLKYKVTPPAVSGSPEFDRIFRAQQNCVEFY
PIFVITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAAKKRIMGFRLSLGILALLTV
LGALGIANSFLDEYLDLNVAKKLRHF
NT seq 441 nt   +upstreamnt  +downstreamnt
atggctgggaatgcaatcttgctggctgctgtctctgtcctctctgcctgtcagcaaagt
tattttgctttgcaggtaggaaaggcaagattaaaatacaaagttacacccccagcagtt
tctggatcaccagagtttgatagaatatttcgtgcacaacagaactgtgtggagttttat
cccatattcgtgattacattgtggatggctggatggtatttcaatcaagtgtttgctact
tgtctgggtctggtgtacatatatgcccgtcaccagtatttctggggatattcagaagca
gctaaaaagaggatcatgggtttccggttgagcctggggattttggccttgttgacagtc
ctaggtgccctggggattgcaaacagcttcctggatgaatacctggacctcaatgttgcc
aagaaactgaggcacttctaa

KEGG   Manis javanica (Malayan pangolin): 108408847
Entry
108408847         CDS       T06054                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00980  Metabolism of xenobiotics by cytochrome P450
mjv00982  Drug metabolism - cytochrome P450
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv01524  Platinum drug resistance
mjv05200  Pathways in cancer
mjv05204  Chemical carcinogenesis
mjv05225  Hepatocellular carcinoma
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108408847 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108408847 (MGST1)
   00982 Drug metabolism - cytochrome P450
    108408847 (MGST1)
   00983 Drug metabolism - other enzymes
    108408847 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108408847 (MGST1)
   05204 Chemical carcinogenesis
    108408847 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108408847 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108408847 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108408847 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108408847 (MGST1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108408847 (MGST1)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108408847 (MGST1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 108408847
NCBI-ProteinID: XP_017534596
LinkDB
Position
Unknown
AA seq 122 aa
KFVSWYLEQAFVNPEDCAVFGKGEEVKKYLWTDNRVERARRAHLNDLENIVPFLGIGLLY
SLSGPDLSTALLHFRLFLGARIYHTIAYLIPLPQPNRALAFYIGYGVTLSMAYRLLKSKL
YL
NT seq 370 nt   +upstreamnt  +downstreamnt
taagtttgtttcttggtatttggaacaggcttttgttaacccagaagactgtgcagtctt
tggcaaaggagaagaggtcaagaagtacctttggacagacaacagagtggaacgtgcacg
aagagcccacctgaatgaccttgagaatattgtgccgttccttggtattggccttctgta
ttccttgagtggcccagatctttccacagccctcctgcatttcagactctttcttggcgc
acggatttaccacaccattgcgtatttgattcccctaccccagccaaaccgtgctttggc
tttttacattggatatggagttactctttcaatggcttacaggttgctcaagagcaaatt
gtacctgtga

DBGET integrated database retrieval system