KEGG   Manis javanica (Malayan pangolin): 108384893
Entry
108384893         CDS       T06054                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04024  cAMP signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04137  Mitophagy - animal
mjv04140  Autophagy - animal
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04310  Wnt signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04530  Tight junction
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04926  Relaxin signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05231  Choline metabolism in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108384893
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108384893
   04012 ErbB signaling pathway
    108384893
   04014 Ras signaling pathway
    108384893
   04310 Wnt signaling pathway
    108384893
   04668 TNF signaling pathway
    108384893
   04068 FoxO signaling pathway
    108384893
   04071 Sphingolipid signaling pathway
    108384893
   04024 cAMP signaling pathway
    108384893
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108384893
   04137 Mitophagy - animal
    108384893
  09143 Cell growth and death
   04210 Apoptosis
    108384893
   04215 Apoptosis - multiple species
    108384893
   04217 Necroptosis
    108384893
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108384893
   04530 Tight junction
    108384893
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108384893
   04621 NOD-like receptor signaling pathway
    108384893
   04622 RIG-I-like receptor signaling pathway
    108384893
   04625 C-type lectin receptor signaling pathway
    108384893
   04660 T cell receptor signaling pathway
    108384893
   04658 Th1 and Th2 cell differentiation
    108384893
   04659 Th17 cell differentiation
    108384893
   04657 IL-17 signaling pathway
    108384893
   04664 Fc epsilon RI signaling pathway
    108384893
  09152 Endocrine system
   04910 Insulin signaling pathway
    108384893
   04920 Adipocytokine signaling pathway
    108384893
   04912 GnRH signaling pathway
    108384893
   04914 Progesterone-mediated oocyte maturation
    108384893
   04917 Prolactin signaling pathway
    108384893
   04926 Relaxin signaling pathway
    108384893
   04935 Growth hormone synthesis, secretion and action
    108384893
  09156 Nervous system
   04728 Dopaminergic synapse
    108384893
   04723 Retrograde endocannabinoid signaling
    108384893
   04722 Neurotrophin signaling pathway
    108384893
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108384893
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108384893
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108384893
   05231 Choline metabolism in cancer
    108384893
  09162 Cancer: specific types
   05210 Colorectal cancer
    108384893
   05212 Pancreatic cancer
    108384893
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108384893
   05012 Parkinson disease
    108384893
   05016 Huntington disease
    108384893
   05017 Spinocerebellar ataxia
    108384893
   05020 Prion disease
    108384893
   05022 Pathways of neurodegeneration - multiple diseases
    108384893
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108384893
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108384893
   04932 Non-alcoholic fatty liver disease
    108384893
   04931 Insulin resistance
    108384893
   04933 AGE-RAGE signaling pathway in diabetic complications
    108384893
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108384893
   05135 Yersinia infection
    108384893
   05133 Pertussis
    108384893
   05152 Tuberculosis
    108384893
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108384893
   05170 Human immunodeficiency virus 1 infection
    108384893
   05161 Hepatitis B
    108384893
   05171 Coronavirus disease - COVID-19
    108384893
   05162 Measles
    108384893
   05167 Kaposi sarcoma-associated herpesvirus infection
    108384893
   05169 Epstein-Barr virus infection
    108384893
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108384893
   05142 Chagas disease
    108384893
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108384893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108384893
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108384893
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108384893
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 108384893
NCBI-ProteinID: XP_017497619
LinkDB
Position
Unknown
AA seq 247 aa
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVTSGSQRPSSASSANDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 744 nt   +upstreamnt  +downstreamnt
atgatgacaccttatgtagtgactcgctactacagagcacctgaggtcatcctaggaatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccggctgactcagagcacaacaaacttaaagccagtcaggcaagggatctattatccaaa
atgctggtaattgatgcatctaaaaggatctccgtagatgaagctctccagcacccatat
atcaatgtctggtatgacccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagagagcacacgatagaagagtggaaagaactgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcccttaggt
gcagcagtgaccagcggctctcagcgcccatcatcagcatcatctgccaatgatgtgtct
tcaatgtcaacagacccgactttggcctcagatacagacagcagtctcgaagcatcagct
ggacctctgggctgctgcagatga

KEGG   Manis javanica (Malayan pangolin): 108385635
Entry
108385635         CDS       T06054                                 

Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04024  cAMP signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04137  Mitophagy - animal
mjv04140  Autophagy - animal
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04310  Wnt signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04530  Tight junction
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04926  Relaxin signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05231  Choline metabolism in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108385635
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385635
   04012 ErbB signaling pathway
    108385635
   04014 Ras signaling pathway
    108385635
   04310 Wnt signaling pathway
    108385635
   04668 TNF signaling pathway
    108385635
   04068 FoxO signaling pathway
    108385635
   04071 Sphingolipid signaling pathway
    108385635
   04024 cAMP signaling pathway
    108385635
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108385635
   04137 Mitophagy - animal
    108385635
  09143 Cell growth and death
   04210 Apoptosis
    108385635
   04215 Apoptosis - multiple species
    108385635
   04217 Necroptosis
    108385635
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385635
   04530 Tight junction
    108385635
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108385635
   04621 NOD-like receptor signaling pathway
    108385635
   04622 RIG-I-like receptor signaling pathway
    108385635
   04625 C-type lectin receptor signaling pathway
    108385635
   04660 T cell receptor signaling pathway
    108385635
   04658 Th1 and Th2 cell differentiation
    108385635
   04659 Th17 cell differentiation
    108385635
   04657 IL-17 signaling pathway
    108385635
   04664 Fc epsilon RI signaling pathway
    108385635
  09152 Endocrine system
   04910 Insulin signaling pathway
    108385635
   04920 Adipocytokine signaling pathway
    108385635
   04912 GnRH signaling pathway
    108385635
   04914 Progesterone-mediated oocyte maturation
    108385635
   04917 Prolactin signaling pathway
    108385635
   04926 Relaxin signaling pathway
    108385635
   04935 Growth hormone synthesis, secretion and action
    108385635
  09156 Nervous system
   04728 Dopaminergic synapse
    108385635
   04723 Retrograde endocannabinoid signaling
    108385635
   04722 Neurotrophin signaling pathway
    108385635
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108385635
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108385635
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385635
   05231 Choline metabolism in cancer
    108385635
  09162 Cancer: specific types
   05210 Colorectal cancer
    108385635
   05212 Pancreatic cancer
    108385635
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108385635
   05012 Parkinson disease
    108385635
   05016 Huntington disease
    108385635
   05017 Spinocerebellar ataxia
    108385635
   05020 Prion disease
    108385635
   05022 Pathways of neurodegeneration - multiple diseases
    108385635
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108385635
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108385635
   04932 Non-alcoholic fatty liver disease
    108385635
   04931 Insulin resistance
    108385635
   04933 AGE-RAGE signaling pathway in diabetic complications
    108385635
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108385635
   05135 Yersinia infection
    108385635
   05133 Pertussis
    108385635
   05152 Tuberculosis
    108385635
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108385635
   05170 Human immunodeficiency virus 1 infection
    108385635
   05161 Hepatitis B
    108385635
   05171 Coronavirus disease - COVID-19
    108385635
   05162 Measles
    108385635
   05167 Kaposi sarcoma-associated herpesvirus infection
    108385635
   05169 Epstein-Barr virus infection
    108385635
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108385635
   05142 Chagas disease
    108385635
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108385635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108385635
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108385635
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108385635
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kinase-like APH Kdo FTA2
Other DBs
NCBI-GeneID: 108385635
NCBI-ProteinID: XP_017498623
LinkDB
Position
Unknown
AA seq 338 aa
MKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQML
CGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEV
ILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTV
RNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDAL
QHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQP
SPSGRSIGWMQLELSTSSREPVVHISPKYESVALMLIA
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaagtgtgtgaaccataaaaatattattagtttattaaatgtcttcacaccccagaaa
acactggaggagttccaggatgtttacttagtaatggaattgatggatgccaatttgtgt
caggtgattcagatggaattagaccatgagcgaatgtcttacctgctataccaaatgttg
tgtggtatcaagcaccttcactctgctggaattattcacagggatttaaaaccgagtaac
attgtagtcaagtctgattgcacattgaaaatccttgacttcggactggccaggacagca
ggcacaagcttcatgatgactccttatgtggtgacgcgttattacagagcccccgaggtc
atcctggggatgggctacaaggagaatgttgacatgtggtcagtagggtgcatcatggga
gaaatgataaaaggtgcagtgctctttcctggcactgatcatattgaccagtggaacaag
gtaattgagcaactaggaacaccatgtccagaattcatgaagaaattgcaacccacagta
agaaactatgtggagaatcggcccaagtatgcaggactcaccttccccaagctctttcca
gattccctcttcccagcggactctgagcacaataaactcaaagccagccaagccagggat
ttgttgtcaaagatgctagtgattgacccagcaaaaaggatatcagtggatgatgcctta
cagcacccatacatcaatgtctggtatgaccctgccgaagtggaggcgcctccacctcag
atttatgacaaacagttggacgagagagaacacaccattgaagaatggaaagaacttatc
tacaaggaagttatgaattcagaagaaaagactaaaaatggtgttgtaaaaggacaacct
tctccttcaggtagaagcataggctggatgcagctggagctgagtaccagctcacgagag
ccagttgtgcacatctctcccaagtatgagtctgttgccctcatgctgatagcttga

KEGG   Manis javanica (Malayan pangolin): 108396943
Entry
108396943         CDS       T06054                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04024  cAMP signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04137  Mitophagy - animal
mjv04140  Autophagy - animal
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04310  Wnt signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04530  Tight junction
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04926  Relaxin signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05231  Choline metabolism in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108396943 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108396943 (MAPK9)
   04012 ErbB signaling pathway
    108396943 (MAPK9)
   04014 Ras signaling pathway
    108396943 (MAPK9)
   04310 Wnt signaling pathway
    108396943 (MAPK9)
   04668 TNF signaling pathway
    108396943 (MAPK9)
   04068 FoxO signaling pathway
    108396943 (MAPK9)
   04071 Sphingolipid signaling pathway
    108396943 (MAPK9)
   04024 cAMP signaling pathway
    108396943 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108396943 (MAPK9)
   04137 Mitophagy - animal
    108396943 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    108396943 (MAPK9)
   04215 Apoptosis - multiple species
    108396943 (MAPK9)
   04217 Necroptosis
    108396943 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108396943 (MAPK9)
   04530 Tight junction
    108396943 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108396943 (MAPK9)
   04621 NOD-like receptor signaling pathway
    108396943 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    108396943 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    108396943 (MAPK9)
   04660 T cell receptor signaling pathway
    108396943 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    108396943 (MAPK9)
   04659 Th17 cell differentiation
    108396943 (MAPK9)
   04657 IL-17 signaling pathway
    108396943 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    108396943 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108396943 (MAPK9)
   04920 Adipocytokine signaling pathway
    108396943 (MAPK9)
   04912 GnRH signaling pathway
    108396943 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    108396943 (MAPK9)
   04917 Prolactin signaling pathway
    108396943 (MAPK9)
   04926 Relaxin signaling pathway
    108396943 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    108396943 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    108396943 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    108396943 (MAPK9)
   04722 Neurotrophin signaling pathway
    108396943 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108396943 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108396943 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108396943 (MAPK9)
   05231 Choline metabolism in cancer
    108396943 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108396943 (MAPK9)
   05212 Pancreatic cancer
    108396943 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108396943 (MAPK9)
   05012 Parkinson disease
    108396943 (MAPK9)
   05016 Huntington disease
    108396943 (MAPK9)
   05017 Spinocerebellar ataxia
    108396943 (MAPK9)
   05020 Prion disease
    108396943 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    108396943 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108396943 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108396943 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    108396943 (MAPK9)
   04931 Insulin resistance
    108396943 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108396943 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108396943 (MAPK9)
   05135 Yersinia infection
    108396943 (MAPK9)
   05133 Pertussis
    108396943 (MAPK9)
   05152 Tuberculosis
    108396943 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108396943 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    108396943 (MAPK9)
   05161 Hepatitis B
    108396943 (MAPK9)
   05171 Coronavirus disease - COVID-19
    108396943 (MAPK9)
   05162 Measles
    108396943 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108396943 (MAPK9)
   05169 Epstein-Barr virus infection
    108396943 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108396943 (MAPK9)
   05142 Chagas disease
    108396943 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108396943 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108396943 (MAPK9)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108396943 (MAPK9)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108396943 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 108396943
NCBI-ProteinID: XP_017515538
LinkDB
Position
Unknown
AA seq 423 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSVDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVNSNTTPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagcaaatgtgacagtcagttttacagtgtacaagtggcagactcaactttc
actgtcctgaaacgttaccagcagttgaaaccaattggctctggagcccagggaattgtt
tgtgctgcttttgatacagttcttggaataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacagaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctgcattcagctggtataattcacagagatttgaagcctagcaacatcgtagtaaaa
tcagactgcacacttaagatccttgacttcggcctggcccggacagcgtgcaccaacttc
atgatgaccccctatgtggtaacgcgctattatcgggcacctgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgaacag
ctagggacaccgtctgtggatttcatgaagaaacttcagccaactgtgaggaattatgta
gaaaacaggcccaagtatcctggcatcaaatttgaagaactctttccagattggatattc
ccatcagaatcggaacgagacaaaataaaaacaagtcaagccagagatttgttatcaaaa
atgttagtgatagatcctgacaagcgcatctctgtggacgaagcattgcgccacccttac
atcaccgtttggtatgatcctgctgaggcagaagcgccaccacctcaaatctatgatgcc
cagttagaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgtaaaagatcaaccttcagatgcagcagta
aatagcaacaccacgccttctcagtcatcatccatcaatgacatttcgtccatgtccacc
gagcagacgctggcctcagacacagacagcagccttgatgcctcaactggacccctggaa
ggttgccgatga

DBGET integrated database retrieval system