KEGG   Manis javanica (Malayan pangolin): 108385007
Entry
108385007         CDS       T06054                                 

Gene name
CD3G
Definition
(RefSeq) T-cell surface glycoprotein CD3 gamma chain
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04640  Hematopoietic cell lineage
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv05142  Chagas disease
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108385007 (CD3G)
   04660 T cell receptor signaling pathway
    108385007 (CD3G)
   04658 Th1 and Th2 cell differentiation
    108385007 (CD3G)
   04659 Th17 cell differentiation
    108385007 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108385007 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108385007 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    108385007 (CD3G)
   05162 Measles
    108385007 (CD3G)
   05169 Epstein-Barr virus infection
    108385007 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108385007 (CD3G)
CD molecules [BR:mjv04090]
 Proteins
  108385007 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3 DUF4469
Other DBs
NCBI-GeneID: 108385007
NCBI-ProteinID: XP_017497765
LinkDB
Position
Unknown
AA seq 181 aa
MEQRKHLASLVLAITVLQGTMAQLKGEKLVIVDDNREDGSVLLTCGLKDQKISWFKDGKE
ISSLNTSKSTWNLGSSAKDPQGMYWCKGPKDRSKPLQVYYRMCQNCIELSAATVSGFVFA
EIISILFLAVGVYFIAGQDGGHQSRASDKQTLLSNDQLYQPLKDREDDPYSHLQGNQLKK
N
NT seq 546 nt   +upstreamnt  +downstreamnt
atggagcagaggaagcacctggccagcctcgtcctggctatcactgttcttcaaggtact
atggcccagttgaaaggagaaaaactggtaatagtggatgacaatcgagaagatggttct
gtacttctgacttgtggcttgaaagaccaaaaaatcagttggtttaaagatgggaaggaa
ataagttccctaaatacaagtaaaagcacatggaatctgggaagcagtgccaaggaccct
caagggatgtactggtgtaaaggaccaaaggaccgttccaaaccactccaagtgtattat
agaatgtgccagaactgcattgagctgagtgcagccactgtatccggctttgtcttcgct
gaaatcatcagcattttattccttgctgttggggtttacttcattgctggacaggatgga
ggtcaccagtcaagagcttcagacaagcagactctgctgtccaatgaccagctctaccag
cccctcaaggaccgggaagatgacccatacagccaccttcaaggaaaccaattgaagaag
aattga

DBGET integrated database retrieval system