KEGG   Manis javanica (Malayan pangolin): 108385153
Entry
108385153         CDS       T06054                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04657  IL-17 signaling pathway
mjv05144  Malaria
mjv05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385153 (CSF3)
   04151 PI3K-Akt signaling pathway
    108385153 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108385153 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108385153 (CSF3)
   04657 IL-17 signaling pathway
    108385153 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108385153 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    108385153 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108385153 (CSF3)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108385153 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 108385153
NCBI-ProteinID: XP_017497957
LinkDB
Position
Unknown
AA seq 195 aa
MKLIALQVLLWHSALWTVQEATPLAPAGSLPPGFLLKCLEQVRKIQADGVALQERLCATH
KLCHPEELVLLGHSLGIPQAPLSSCSSQALQLTGCLSQFHSGLVLYQGLLQALAGISPEP
APALDTLQLDVTDFATYIWQQMEDLGMAPDVQPTQGTLPTFTSAFQRRAGGVLVASNLQS
FLELAYRVLRHLAKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgatagccctgcaggtgctgctctggcacagtgcgctctggacggtgcaagag
gccaccccgctggcccctgctggctccctgcccccgggcttcctgctcaagtgcttagaa
caagtgagaaagatccaggctgatggcgtggcactgcaggagaggctgtgcgccacccac
aagctgtgccaccctgaggagctggtgctgctcggacactctctgggcatcccccaggct
cccctgagcagctgctccagccaagccctgcagctgacgggctgcctgagccaattccac
agtggcctcgtcctctaccagggcctcctgcaggccctggcagggatctccccggagcca
gcccccgccttggacacgctgcagctggatgtcaccgacttcgccacctacatctggcag
cagatggaagacctggggatggcccctgatgtgcagcccacccagggcaccctgcccacc
ttcacctcggccttccagcgccgggcaggaggcgtcctggtggcctccaacctgcagagc
ttcctggagctggcataccgtgttttgcgtcaccttgccaagccctga

KEGG   Manis javanica (Malayan pangolin): 108385400
Entry
108385400         CDS       T06054                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385400 (PRL)
   04151 PI3K-Akt signaling pathway
    108385400 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108385400 (PRL)
   04060 Cytokine-cytokine receptor interaction
    108385400 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108385400 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108385400 (PRL)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108385400 (PRL)
SSDB
Motif
Pfam: Hormone_1 KIAA1430
Other DBs
NCBI-GeneID: 108385400
NCBI-ProteinID: XP_017498313
LinkDB
Position
Unknown
AA seq 228 aa
MDKTGLSQKGSFTLLLLASSLLLCKSTAPLPICPSGAVNCQVSLRDLFDRAVILSHYIHK
LSSEMFSEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIRHEDLLNLVLGVLRSW
NGPLYHLVAEVRGMREAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGVKENEVSSVWA
GLPSLRMADEDARLFAFYNLLHCLRRDSHKIDNYLKILKCRIVHNSNC
NT seq 687 nt   +upstreamnt  +downstreamnt
atggacaagacagggttgtcgcagaaagggtcattcacgctcctactgctggcgtcaagt
ctgcttctgtgcaagagcacagcacccctgcccatctgccccagtggggctgtcaactgc
caggtgtccctccgagacctgtttgaccgcgccgtcatcctgtctcactacatccataaa
ctctcctcagaaatgttcagcgaatttgacaaacgatatgcccagggccgggggttcatt
accaaggccatcaacagctgccacacttcatccctctctacccctgaggacaaggagcaa
gcccaacagatccggcacgaagacctcctgaacctggtcctcggggtgctgcgctcctgg
aacggccctctctaccacctggtcgcggaagtacgcggcatgcgggaggcccccgatgcc
atcctgtcgagagcgatagagatcgaagaacagaacaaacgcctcctggagggcatggag
aagatagtcggccaggttcaccctggagtgaaagaaaacgaggtctcctccgtgtgggcg
ggactgccgtccctgcggatggccgatgaggacgctcgcctcttcgctttttataacctg
ctccactgcctgcgcagggattcgcataagatcgacaactacctcaagatcctgaagtgc
cgcatagtccacaacagcaactgctaa

KEGG   Manis javanica (Malayan pangolin): 108395274
Entry
108395274         CDS       T06054                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108395274 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108395274 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108395274 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108395274 (THPO)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108395274 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108395274
NCBI-ProteinID: XP_017512923
LinkDB
Position
Unknown
AA seq 415 aa
MTTVRALAILGWIEPRPSSLAHLCPTQLCPEVQEPKPPPWPPEGFRGEAPYREPLQADSP
ARMERTELLLVVILLLTSRLTPSSPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVKPLST
PVLLPAVDFSLGEWKSQTEQSKAQDILGAATLLLEGVMAARGQVGPTCLTSLLGQLSGQI
RLLLGALQGLLGIQLPPQGRTTAHKDPNAIFLSFQQLLRGKVRFLLLVVGPTLCAKRALP
TTAGPSSASLFLTLHKLPNRTSGLLETDTSVPARTTGSGLLKRLQRFRAKIPGLLSQTAR
SLDQIPGHLNRTHGPLNGTHGLFPGPSPRVLEALDIPPGTSDMGSLPPYLQPGYSPSPSH
PPTGQYSLFSSLPTLPTPMVQLQPQVPDPSAITPSSTSPLLIAAHPHFQNLSQEE
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgacaacagtcagagctttagcaattctaggctggatagaacccagaccttcttccttg
gcccacctgtgccccacccaactctgcccagaagtgcaagagcctaagccgcctccatgg
cccccggaaggattcaggggagaggccccatacagggagccactccaagcagacagcccg
gccagaatggagcggactgaactgctcctcgtggtcatacttctcctaacttcaagacta
actccatctagcccggctcctcctgcctgtgacccccgactcctaaataaactgcttcgt
gactcacacgtccttcacagcagactgagccagtgcccagacgttaagcctttgtctaca
cctgtcctgctgcctgctgtggacttcagcttaggagaatggaaatcccagacagagcag
tccaaggcccaggacattctaggagcagcgacccttctgctggagggtgtgatggcagca
cggggacaagtaggacccacttgcctcacatccctactgggacagctttctggacagatc
cgcctcctccttggagccctgcagggcctccttggaatccagcttcctccacagggcagg
accacagctcacaaggatcccaatgccatcttcctgagcttccaacagttgctccgagga
aaggtgcgtttcctgctgcttgtggtggggcccactctctgtgccaagcgggccctcccc
accacagctggcccaagcagtgcctctctattcctcacactacacaagctcccaaacagg
acttctggattgttggagacagacaccagtgtcccagccagaactactggctctgggctt
ctgaagaggctgcagagattcagagccaaaattcctggtctgctgagccaaactgccagg
tccctagaccaaatccctggacacctgaacaggacacatggacccttgaatggaactcat
ggactctttcctggaccttcacccagggtcctagaagccctggacattcctccaggaact
tcagacatgggctccctgccaccctacctccagcctggatattctccttccccaagccat
cctcctactggacaatactcactcttctcttctttacccaccttgcccacccccatggtc
cagctccaaccccaagttcctgacccctctgctatcacacccagctccaccagtcctctt
ctaattgcagcccaccctcacttccagaatctttctcaggaagagtaa

KEGG   Manis javanica (Malayan pangolin): 108395315
Entry
108395315         CDS       T06054                                 

Gene name
LEP
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04152  AMPK signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108395315 (LEP)
   04152 AMPK signaling pathway
    108395315 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108395315 (LEP)
   04060 Cytokine-cytokine receptor interaction
    108395315 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108395315 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108395315 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108395315 (LEP)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108395315 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 108395315
NCBI-ProteinID: XP_017512977
LinkDB
Position
Unknown
AA seq 167 aa
MHCGPLWQFLWLWPYLSYIETVPIQKVQDDTKTLIKTIVTRISDISHTQLVSSKQRVTGL
DFIPGLHPVLSLSKMDQTLVVYQQILTRLPSRNVIQISNDLENLRDLLHLMAFSKSCPLP
RARGLGTLENLGGILEASLYSTEVVALSRLQASLQDMLRQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattgtggacccctgtggcaattcctgtggctttggccctatctctcctacattgaa
actgtacccatccaaaaagtccaggatgacaccaaaaccctcatcaagacaattgtcacc
aggatcagtgacatttcacacacgcagttggtttcctccaaacagcgtgtcaccggtttg
gactttattcctgggctccaccctgtcctgagtttgtccaagatggaccagacattggta
gtctaccaacagatcctcacccgtctgccttccagaaatgtaatccaaatatctaatgac
ctggagaacctccgggaccttctccacctgatggccttctccaagagctgtcccttgccc
agggccaggggcctggggaccttggagaacctgggtggcatcctggaagcttcactctac
tccacagaggtggtggccctgagcaggctgcaggcgtcactgcaggacatgctgcggcag
ctggacctcagccctgggtgctga

KEGG   Manis javanica (Malayan pangolin): 108398074
Entry
108398074         CDS       T06054                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108398074 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398074 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108398074 (CNTF)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108398074 (CNTF)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 108398074
NCBI-ProteinID: XP_017517335
LinkDB
Position
Unknown
AA seq 200 aa
MAFATHSPLTSHHRDLCSRSIWLARKIGSDLTALMESYMKHQGLSENINLDSVDGVPAAS
TDRWGELSEAERLQESLQAYRTFHVMLARLLEDQRVHFTPAEGDFHQAIHMLLLQVAAFA
YQIEELMVLLEHKIPPSESGGTPVTVGDGDLFEKKLWGLKVLQELSHWTVRSIHDLRVIS
CPQTGIPAHGSPYIAEDKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcgcaacgcattcaccgctgacctctcaccaccgggacctctgtagccgctct
atctggctagcgaggaagattggttcagacctgactgctcttatggaatcttatatgaag
catcagggcctgagcgagaacataaacctggactccgtggatggggtgccagcagccagc
acagatcggtggggcgagctgagtgaggcagagcggctccaagagagccttcaagcttac
cgcaccttccatgtcatgttggccaggcttttagaagaccagcgggtgcactttactcca
gctgaaggcgacttccatcaagcaatacatatgcttctactccaagttgccgcctttgct
taccagatagaggaattaatggtgctcctggaacacaagatccctcccagtgagtctggt
ggcacgcctgttaccgttggagatggtgatctctttgagaagaagttgtggggtctgaag
gtgctgcaagagctttcacattggacagtgaggtccatccatgaccttcgagtcatttct
tgtcctcagactgggatcccagcacatgggagcccatacattgccgaagacaagaagatg
tag

KEGG   Manis javanica (Malayan pangolin): 108403155
Entry
108403155         CDS       T06054                                 

Definition
(RefSeq) somatotropin isoform X1
  KO
K05438  growth hormone
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04080  Neuroactive ligand-receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403155
   04151 PI3K-Akt signaling pathway
    108403155
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108403155
   04060 Cytokine-cytokine receptor interaction
    108403155
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    108403155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403155
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108403155
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 108403155
NCBI-ProteinID: XP_017525618
LinkDB
Position
Unknown
AA seq 231 aa
MRSRLAGCPAPGPAHPSLGSGTSALLALALLCLPWPQEVGAFPPMPLSSLFANAVLRAQH
LHQLAADTYKEFERAYIPEGQRYSIQNTQAAFCFSETIPAPTGKDEAQQRSDVELLRFSL
LLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQ
TYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 696 nt   +upstreamnt  +downstreamnt
atgcggagcaggctggcaggatgcccagcccctggccctgcccatccctctctaggctct
gggacctccgcgctcctggcgctggccctgctctgcctgccctggcctcaggaggtgggc
gccttcccgcccatgcccttgtccagcctgtttgccaatgctgtgctccgggcccagcac
ctgcaccaactggctgctgacacctacaaagagtttgagcgcgcctacatcccggaggga
cagagatactccatccagaacacacaggccgccttctgcttctcggagaccatcccggcg
cccacgggcaaggacgaggcccagcagagatccgacgtggagctgctgcgcttctcgctg
ctgctcatccagtcgtggctcgggcccgtgcagttcctcagccgggtcttcaccaacagc
ctggtgttcggcacctcggaccgcgtctacgagaagctgaaggacctggaggagggcatc
caggccctgatgcgggagctggaagatggcagcccccgggctgggcagattctcaagcag
acctatgacaagtttgacaccaacttgcgcagtgacgacgcgctgctcaagaactacggg
ctgctctcctgcttcaagaaggacctgcacaaggccgagacatacctgcgggtcatgaaa
tgtcgccgctttgtggaaagcagctgtgccttctag

KEGG   Manis javanica (Malayan pangolin): 108409376
Entry
108409376         CDS       T06054                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04066  HIF-1 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108409376 (EPO)
   04066 HIF-1 signaling pathway
    108409376 (EPO)
   04151 PI3K-Akt signaling pathway
    108409376 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409376 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108409376 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108409376 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108409376 (EPO)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  CSF and other factors
   108409376 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108409376
NCBI-ProteinID: XP_017535406
LinkDB
Position
Unknown
AA seq 192 aa
MGVRECPALLLLFSLLLLPLGLPVMGALPHLICDSRVLERYILEAREAENATMGCAESCS
FGENITVPDTKVNFHAWKRMEVGQQATEVWQGLALLSEAILRGQALLANSSQPVETLHLH
VDKAISGLRSLTSLLRALGAQKEAISLPDTASAAPLRTFSVDTLCKLFRIYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccctgctcctgctgttctctttgctgctgctccctctg
ggcctccccgtcatgggtgctctgccacaccttatctgtgacagccgagtcctggagagg
tacatcctggaggccagggaggctgaaaatgccacgatgggctgtgcggaaagctgcagt
tttggtgagaatatcaccgtcccagacaccaaagttaacttccatgcttggaagaggatg
gaggtcgggcagcaggccacagaagtatggcagggcctagccctgctctcagaagccata
cttcggggccaggccctgctggccaattcctcccagccggttgagaccctgcatctgcat
gtggataaagccatcagcggtttgcgcagcctcacatccctgcttcgggcgctgggagcc
cagaaggaagccatctcccttccagacacagcctctgctgctccactccgaacattctct
gttgatactttgtgcaaactttttcgaatctactccaattttctgcggggaaagctgaag
ctgtacacaggggaagcctgcaggagaggggacaggtga

DBGET integrated database retrieval system