Manis javanica (Malayan pangolin): 108385222 Help Entry 108385222         CDS       T06054                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv01524   Platinum drug resistance mjv04064   NF-kappa B signaling pathway mjv04066   HIF-1 signaling pathway mjv04071   Sphingolipid signaling pathway mjv04115   p53 signaling pathway mjv04140   Autophagy - animal mjv04141   Protein processing in endoplasmic reticulum mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04215   Apoptosis - multiple species mjv04217   Necroptosis mjv04261   Adrenergic signaling in cardiomyocytes mjv04340   Hedgehog signaling pathway mjv04510   Focal adhesion mjv04621   NOD-like receptor signaling pathway mjv04630   JAK-STAT signaling pathway mjv04722   Neurotrophin signaling pathway mjv04725   Cholinergic synapse mjv04915   Estrogen signaling pathway mjv04928   Parathyroid hormone synthesis, secretion and action mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv05014   Amyotrophic lateral sclerosis mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05161   Hepatitis B mjv05162   Measles mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05215   Prostate cancer mjv05222   Small cell lung cancer mjv05226   Gastric cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108385222 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     108385222 (BCL2)    04630 JAK-STAT signaling pathway     108385222 (BCL2)    04064 NF-kappa B signaling pathway     108385222 (BCL2)    04066 HIF-1 signaling pathway     108385222 (BCL2)    04071 Sphingolipid signaling pathway     108385222 (BCL2)    04151 PI3K-Akt signaling pathway     108385222 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108385222 (BCL2)   09143 Cell growth and death    04210 Apoptosis     108385222 (BCL2)    04215 Apoptosis - multiple species     108385222 (BCL2)    04217 Necroptosis     108385222 (BCL2)    04115 p53 signaling pathway     108385222 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108385222 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108385222 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     108385222 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     108385222 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108385222 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     108385222 (BCL2)    04722 Neurotrophin signaling pathway     108385222 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108385222 (BCL2)    05206 MicroRNAs in cancer     108385222 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     108385222 (BCL2)    05226 Gastric cancer     108385222 (BCL2)    05215 Prostate cancer     108385222 (BCL2)    05222 Small cell lung cancer     108385222 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108385222 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     108385222 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108385222 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108385222 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     108385222 (BCL2)    05152 Tuberculosis     108385222 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108385222 (BCL2)    05161 Hepatitis B     108385222 (BCL2)    05162 Measles     108385222 (BCL2)    05168 Herpes simplex virus 1 infection     108385222 (BCL2)    05169 Epstein-Barr virus infection     108385222 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108385222 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     108385222 (BCL2)    01524 Platinum drug resistance     108385222 (BCL2)    01522 Endocrine resistance     108385222 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mjv01009]     108385222 (BCL2) Protein phosphatases and associated proteins [BR:mjv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      108385222 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  108385222 NCBI-ProteinID:  XP_017498051 LinkDB All DBs Position Unknown AA seq 229 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGGAGAAPPGAASAPGVFSSQPXXXXXXX XXXXXXXAAAAAGPALIPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ DNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 690 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatacac tataagctgtcgcagaggggctacgagtgggaagccggaggtgcgggcgcagcgcccccc ggtgccgcctccgcgccgggagtcttctcctcgcagccnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnccgccgccgccgctgcggggcctgcgctcatccccgtgcca cctgtggtccacctgaccctgcgccaggccggcgatgacttctcccggcgctaccgccgc gacttcgccgagatgtccagccagctgcacctgacacccttcaccgcaaggggacgcttt gccacggtggtggaagagctcttcagggatggggtgaactgggggaggattgtggccttc tttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg gacaatatcgccctgtggatgactgagtacctgaaccggcacctgcacacctggatccag gataacggaggctgggacgcctttgtggaactctatggccccagcatgcagcctctgttt gacttctcctggctgtctctcaaggccctgctcagtctggccctggtgggcgcctgcatc accctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system