KEGG   Manis javanica (Malayan pangolin): 108385222
Entry
108385222         CDS       T06054                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04064  NF-kappa B signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04115  p53 signaling pathway
mjv04140  Autophagy - animal
mjv04141  Protein processing in endoplasmic reticulum
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04340  Hedgehog signaling pathway
mjv04510  Focal adhesion
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04725  Cholinergic synapse
mjv04915  Estrogen signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05014  Amyotrophic lateral sclerosis
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05162  Measles
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05215  Prostate cancer
mjv05222  Small cell lung cancer
mjv05226  Gastric cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108385222 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    108385222 (BCL2)
   04630 JAK-STAT signaling pathway
    108385222 (BCL2)
   04064 NF-kappa B signaling pathway
    108385222 (BCL2)
   04066 HIF-1 signaling pathway
    108385222 (BCL2)
   04071 Sphingolipid signaling pathway
    108385222 (BCL2)
   04151 PI3K-Akt signaling pathway
    108385222 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108385222 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    108385222 (BCL2)
   04215 Apoptosis - multiple species
    108385222 (BCL2)
   04217 Necroptosis
    108385222 (BCL2)
   04115 p53 signaling pathway
    108385222 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385222 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108385222 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108385222 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    108385222 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108385222 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    108385222 (BCL2)
   04722 Neurotrophin signaling pathway
    108385222 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385222 (BCL2)
   05206 MicroRNAs in cancer
    108385222 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108385222 (BCL2)
   05226 Gastric cancer
    108385222 (BCL2)
   05215 Prostate cancer
    108385222 (BCL2)
   05222 Small cell lung cancer
    108385222 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108385222 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    108385222 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108385222 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108385222 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108385222 (BCL2)
   05152 Tuberculosis
    108385222 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108385222 (BCL2)
   05161 Hepatitis B
    108385222 (BCL2)
   05162 Measles
    108385222 (BCL2)
   05168 Herpes simplex virus 1 infection
    108385222 (BCL2)
   05169 Epstein-Barr virus infection
    108385222 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108385222 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385222 (BCL2)
   01524 Platinum drug resistance
    108385222 (BCL2)
   01522 Endocrine resistance
    108385222 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108385222 (BCL2)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108385222 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 108385222
NCBI-ProteinID: XP_017498051
LinkDB
Position
Unknown
AA seq 229 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGGAGAAPPGAASAPGVFSSQPXXXXXXX
XXXXXXXAAAAAGPALIPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ
DNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatacac
tataagctgtcgcagaggggctacgagtgggaagccggaggtgcgggcgcagcgcccccc
ggtgccgcctccgcgccgggagtcttctcctcgcagccnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnccgccgccgccgctgcggggcctgcgctcatccccgtgcca
cctgtggtccacctgaccctgcgccaggccggcgatgacttctcccggcgctaccgccgc
gacttcgccgagatgtccagccagctgcacctgacacccttcaccgcaaggggacgcttt
gccacggtggtggaagagctcttcagggatggggtgaactgggggaggattgtggccttc
tttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg
gacaatatcgccctgtggatgactgagtacctgaaccggcacctgcacacctggatccag
gataacggaggctgggacgcctttgtggaactctatggccccagcatgcagcctctgttt
gacttctcctggctgtctctcaaggccctgctcagtctggccctggtgggcgcctgcatc
accctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system