KEGG   Manis javanica (Malayan pangolin): 108385429
Entry
108385429         CDS       T06054                                 

Gene name
SOCS6
Definition
(RefSeq) LOW QUALITY PROTEIN: suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108385429 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108385429 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108385429 (SOCS6)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108385429 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 108385429
NCBI-ProteinID: XP_017498362
LinkDB
Position
Unknown
AA seq 467 aa
MKKISLKTFRKSFNLNKSKEETDFMVVQQPSLAGDFGKDDSIFGSCYGKDMANCDINSDD
EKSGKNRPKGESLMGTLKRRLSVKQKQKGKGGAAAGGADEDSFSSASAPLVFKDVRAPRP
VRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHASSPGPALNGVRKDFHDLQAE
TVCQEPGSALRRSASPSGDLRLRLDEHVPVVLGLVPQDYIQYTVPLDEGVCPLAGPRGCC
PDGPSPMEVSAVPAGSGPCPGDEAXXXXAESVRCHLHFDPTSAPGVARVYDSVQSSGPLA
VTSLTEELKKLAKQGWYWGPITRWEAEGKLASVPDGSFLVRDSSDDRYLLSLSFRSHGKT
LHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLT
NPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttccggaaatctttcaacttgaataaaagtaaagaa
gagacggatttcatggtagtccagcaaccctcactcgccggtgatttcggaaaagacgac
tccatattcggtagctgctatgggaaagatatggccaactgcgatatcaacagcgacgac
gagaaaagtggaaaaaacaggccaaaaggggaaagcctgatgggcacgctgaagagacgg
ctttcggtgaagcagaagcagaagggtaagggcggcgcggcggcggggggcgcggacgag
gacagcttctcctcggcctcggcgcccctggtcttcaaggacgtgagggccccgaggccg
gtgaggtccacgtcgctgcgcagccaccactacagccccacgccgtggcccctgcgcccc
accaactccgaggagacgtgcatcaaaatggaggtgcgcgtcaaggccttggtgcacgcg
tccagcccggggcccgcgctgaacggcgtccggaaggacttccacgaccttcaggccgaa
accgtgtgccaggagccgggcagcgcgctcaggaggtcagcctccccgagcggagacctg
cgcctgcgcctggacgagcacgtgcccgtggtcctcggactcgtgcctcaggactacatc
cagtacactgtgcctttggacgagggcgtgtgcccgctggcggggccgcgcggctgctgc
ccggacggcccctcccccatggaggtgtccgcggtgcccgcgggcagcggcccctgcccc
ggagacgaggcnnnnnnnnnnnnggccgagagcgtgcgctgccacctgcacttcgacccc
acctccgcccccggggtcgcccgggtctacgactcggtgcagagcagcggccccctggcc
gtgacgagccttacggaggagctgaagaagctcgccaagcagggctggtactggggcccg
atcacgcgctgggaggccgagggcaagctggccagcgtgcccgacggctccttcctggtt
cgggacagttctgacgaccgctaccttctaagcctgagcttccgctcccacggcaaaacg
cttcacactagaatcgagcactcaaacggtaggtttagcttttacgaacaaccagacgtg
gaaggacatacgtctatagttgatctaattgagcattcaatcagggactctgagaatgga
gctttttgttactcgagatctcggttgcctgggtctgcgacctaccccgtcagactgacc
aatccggtgtcgcggttcatgcaggtgcgctccttgcagtacctgtgtcgcttcgtcatc
cgccagtataccaggatagacttaattcagaaactgcctttgccaaacaaaatgaaggat
tacttacaggagaagcactactga

KEGG   Manis javanica (Malayan pangolin): 108387701
Entry
108387701         CDS       T06054                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108387701 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108387701 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108387701 (SOCS5)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108387701 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 108387701
NCBI-ProteinID: XP_017501538
LinkDB
Position
Unknown
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGGSHSENVDMNSNRCLSGKEKNIGIGDSTPQQQSSPLR
DSVALQLGFSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVIPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDSEKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGFCFPMRTYNKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEINGDSSVIPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLDGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSVLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaagtacaggtgtcagaatctcttcagt
catgagggaggaagccatagtgaaaatgtggacatgaactccaacagatgtttgtctggc
aaagagaaaaacattggtataggagactcaactcctcagcaacaaagcagtcccttaaga
gacagtgttgccttacaactgggatttagcccctcaaagaattcttcaaggagaaaccaa
aactgtgccactgaaattcctcagattgttgaaataagcatagaaaaggataatgattca
tgtgtcatcccaggaacaagacttgcgagaagagattcctattctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttccacaaagacccagagttcattggatagtgagaaa
aagtttgggagaacgcgaagtggacttcaaaggcgagagaggcgatatggcgtaagctct
gtacatgatatggacagcgtttccagcagaactgtaggaagtcgctctctgagacaaagg
ttgcaggatactgtgggcttctgttttcccatgagaacttacaacaagcagtcaaaaccc
ctcttttctaataaaagaaaaatacacctttcagaattaatgcttgagaaatgccctttt
cctgctggttcggatttagcccaaaaatggcatttaattaaacagcatacagcccctgtg
agcccacattcaacattttttgatacatttgatccatccttggtttccacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgacccccctccc
aatgcgcaaatacatacgtttgaagccactgcacaggttaatccattatataaactggga
ccaaagctagctcctggaatgactgaaataaatggggacagttctgtaattccacaggct
aattgtgactcagaagaggacacaaccaccctgtgtttgcagtcacggaggcagaagcaa
cgtcaggtgtctggagacagccatgcccatgttagcaggcagggagcctggaaagttcac
acgcagattgattacatacactgccttgtgcccgacttgcttcagattaccggtaacccc
tgttactggggagtgatggaccgctatgaagcagaagcccttcttgatgggaaacctgaa
ggcacatttttgctcagggactctgcacaagaggactacctcttctctgtgagctttcgg
cgctacaacagatccctgcatgcccgaattgaacagtggaatcacaactttagttttgat
gctcatgacccatgtgtgtttcactcctccactgtaacaggacttttggaacactataag
gatcccagttcttgcatgttttttgaaccgttgcttactatatcactaaataggactttc
cctttcagtctgcagtacatctgtcgcgcagtaatctgcaggtgcaccacatatgatgga
attgatgggctccctttaccatcagtgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttagaaagagaaccagtcaaggcaaagtaa

KEGG   Manis javanica (Malayan pangolin): 108396005
Entry
108396005         CDS       T06054                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04910  Insulin signaling pathway
mjv04917  Prolactin signaling pathway
mjv04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396005 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108396005 (SOCS4)
   04917 Prolactin signaling pathway
    108396005 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108396005 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108396005 (SOCS4)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108396005 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 108396005
NCBI-ProteinID: XP_017514173
LinkDB
Position
Unknown
AA seq 440 aa
MAESSENNCKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNAVEKTEV
PLRSRERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKQHTAPISPKSDDWVATDLSQNELRDGQLKQRN
VEEERNCFSHTNVQPCVITTNSASCRSGPVTGSLMNLISNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaagtagtgaaaacaattgtaaaaatgtagatgtaaggcccaaaactagtcgg
agtagaagtgctgacagaaaggatggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgaaagttattctgatgctgaaactgtgaatgctgtagagaaaactgaagtt
cctctgaggagccgagaacggaagcacagctgctcatccatcgagttggatttagaccat
tcttgtgggcatagatttttaggccgatctcttaaacaaaaactgcaggatgctgtgggg
cagtgttttcccataaaaaattgtagtagtcgacactcttcagggcttccatctaaaaga
aaaattcatatcagtgaactcatgctagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacaacacactgctcctataagtcccaaatcagatgac
tgggtagccacagacttgtctcagaatgaattgagggatggtcagctaaaacaaagaaac
gtggaagaagagagaaactgtttctcacataccaatgttcagccctgtgtcataaccacc
aacagtgcttcgtgtagaagtggtcctgtcactggctctttgatgaaccttatttcaaat
aatagtatagaagatagtgatatggattcagatgatgaaattataacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggaaatggatgaagaaatcctgcagttggaaaca
cctcctaagtatcacacccagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaatccatgttattggggagttatggataaatatgcagctgaagctctacta
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacaatggaatcac
aactttagctttgatgcacatgatccttgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagtgcctgtatgttctttgaaccacttttatccactcct
ttaattcggactttccccttctccctgcaacatatatgcagaacagttatttgtaactgt
acaacttatgatggcattgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcactataaatcaaaagtcagagtacttaggattgatgcaccagaacaacaatgc
tag

KEGG   Manis javanica (Malayan pangolin): 108396412
Entry
108396412         CDS       T06054                                 

Gene name
SOCS7
Definition
(RefSeq) LOW QUALITY PROTEIN: suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396412 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108396412 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108396412 (SOCS7)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108396412 (SOCS7)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 108396412
NCBI-ProteinID: XP_017514773
LinkDB
Position
Unknown
AA seq 500 aa
MVFRNVGRPPEEEDAEAAPEPGASDLLCPRHRCALDPKALPPGLALERTWGPAAGLXTWG
PAAGLEAQLAALGLGQPAGPGIKTVSGGCCPCPCPPQLPPPQPQPPTAAPQAGEDPTETS
DALLVLEGLESEAESLETNSCSEEELSSPGRGGGGSGRLLLQPPGPELPPVPFPMQDLVP
PGRLSRGDQQLQPPPPLPPEPLRPLAGPSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKR
PSGDLAASAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDIS
QRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAF
PRIAPVRAAESLHNQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKG
KPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIK
RAIMHSKNGKFLYFLRSRVP
NT seq 1501 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtaggtcggccgccggaggaggaggacgcagaggcagccccagag
ccgggagcctcggacctgctgtgtccccggcaccgctgtgccctggaccccaaggccctg
ccgccgggattggcgctcgagcggacctggggcccggcggctggactagngacctggggc
ccggcggctggactagaggcacagttggcggctttggggctcgggcagccggcagggccg
ggaatcaagacggtcagtgggggttgctgcccgtgcccgtgccccccgcagctgccccct
ccgcagccccagccgcctactgccgccccgcaggccggggaggaccccacggaaacgagc
gacgcgctgctggtcctggagggcttggagtcggaagcggagagcctggagactaacagc
tgctcggaagaggagctcagcagcccgggccgcggaggaggagggagcggccggcttctg
ctgcagcccccaggccccgaattacccccggtgcccttcccgatgcaggacttggtccct
ccagggcgattgagtagaggtgaccaacagctgcaacctcccccgccgcttcctcctgag
cccctccggccgctcgcaggcccttctcggaagggctcccttaaaatccgcctcagtcgc
ctctttcgcacgaagagctgcaacggtggctccggcggcggggatggggccggcaagagg
ccgtctggagatctggctgcttcagctgcgagcttgacagacatgggaggctctgcgggc
cgggagctggacgcggggaggaaacccaggttgacacgaactcaaagtgccttttctcca
gtctccttcagccccctgttcacaggtgaaacagtgtcacttgtggatgtcgacatctct
cagcggggcctgacctctcctcacccaccaactccccctcctcctccgagaagaagcctc
agcctcctagatgatatcagtgggacgctgcctacatctgtccttgtggctccgatgggg
tcttccctgcagtctttccccctacctccgcctcctccaccccatgccccagatgcattt
ccccggattgctcccgtccgagcagctgaatccctgcacaaccagcccccccagcacctt
cagtgtcccctctaccggcctgactcaagcagctttgcagccagccttcgagagctggag
aagtgtggatggtattggggaccaatgaattgggaagatgcagagatgaagctgaaaggg
aagccagatggttctttcctggtacgcgacagctctgatcctcgttatatcctgagtctc
agtttccgatcacagggtatcacccatcacactagaatggagcactacagaggaaccttc
agcctgtggtgtcatcccaagtttgaggatcgttgtcaatcagtggtggagttcattaaa
agagcaatcatgcactccaagaatgggaagtttctctatttcttgagatccagagtacca
g

KEGG   Manis javanica (Malayan pangolin): 108400461
Entry
108400461         CDS       T06054                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04910  Insulin signaling pathway
mjv04917  Prolactin signaling pathway
mjv04930  Type II diabetes mellitus
mjv04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400461 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108400461 (SOCS2)
   04917 Prolactin signaling pathway
    108400461 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    108400461 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108400461 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108400461 (SOCS2)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108400461 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 108400461
NCBI-ProteinID: XP_017521323
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCLEPSGNGAEGTRSQWGTAGSAEEPSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPALQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcgaagccagtgg
gggaccgcggggtccgcggaggagccgtcgccggaggcggcgcgtctggcgaaggccctg
cgggagctcagtcaaacaggttggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactgacaatatctgttaaaacatcagctggaccaactaatctgcgaatcgaataccag
gatgggaaattcagattggactctatcatatgtgtcaagtccaagcttaagcagtttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaatggcactgttcacctttatctgaccaaacctctctacacgtcggca
ccagccctgcagcatctctgtagactcaccattaacaaatgtaccggtaccatctgggga
ctgcctttaccaacgagactcaaagattacttggaagaatataaattccaggtataa

KEGG   Manis javanica (Malayan pangolin): 108405554
Entry
108405554         CDS       T06054                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04380  Osteoclast differentiation
mjv04630  JAK-STAT signaling pathway
mjv04910  Insulin signaling pathway
mjv04917  Prolactin signaling pathway
mjv04930  Type II diabetes mellitus
mjv04935  Growth hormone synthesis, secretion and action
mjv05145  Toxoplasmosis
mjv05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108405554 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405554 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108405554 (SOCS1)
   04917 Prolactin signaling pathway
    108405554 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    108405554 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108405554 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108405554 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108405554 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108405554 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108405554 (SOCS1)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108405554 (SOCS1)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 108405554
NCBI-ProteinID: XP_017529271
LinkDB
Position
Unknown
AA seq 266 aa
MRTTLERAAPTPAPAPGDTHFRTFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLR
TEPVGTFLVRDSRQRNCFFALSSTARGVPAAQVFLLFAQIAGTKRKSPAGQQAAAKGRRA
GGRVAGVGAVTSPRDLSARRSVTQTPNDPEAGLHAHRAPSRLESLTPPQVVSRAIACPDS
VLTASVSQQRTPGRYGPPLRLAPRLLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAT
VGRENLARIPLNPVLRDYLSSFPFQI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgcgcacaacgctagaacgagcggccccgaccccggccccggcccccggcgacacacac
ttccgcacgttccgctcgcacgccgagtaccggcgcatcacccgagccagcgcgctcctc
gacgcctgcggcttctactgggggcccctgagcgtgcacggggcgcacgagcggctgcgc
accgagcccgtgggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgcc
ctcagctccaccgcgcgtggggttcccgcagcgcaggtttttctcctgtttgcgcaaatc
gccgggacgaagcgcaaatccccggctggccagcaggcggcggccaaggggcggcgagca
gggggccgggtggccggagtcggggcagtcacttctccccgggacctctctgcacgccgc
tctgtcacccaaactccgaacgacccagaggctggactccacgcgcaccgagcacccagc
cgcctggaaagcctcacgcctccccaagtggtgtcgcgggccatcgcctgcccagactct
gtgctcactgcctctgtctcccagcagcgcacccccggacgctatggcccaccccttcgg
ctggccccgcgtctgctggagcactacgtggcggcgccgcgccgcatgctgggggccccg
ctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccagcgcatcgtggccacc
gtgggccgcgagaacctggcgcgcatccccctcaaccccgtcctccgcgactacttgagc
tccttccccttccagatctga

KEGG   Manis javanica (Malayan pangolin): 108407802
Entry
108407802         CDS       T06054                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04380  Osteoclast differentiation
mjv04630  JAK-STAT signaling pathway
mjv04668  TNF signaling pathway
mjv04910  Insulin signaling pathway
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04935  Growth hormone synthesis, secretion and action
mjv05160  Hepatitis C
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108407802 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108407802 (SOCS3)
   04668 TNF signaling pathway
    108407802 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108407802 (SOCS3)
   04920 Adipocytokine signaling pathway
    108407802 (SOCS3)
   04917 Prolactin signaling pathway
    108407802 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    108407802 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108407802 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108407802 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    108407802 (SOCS3)
   04931 Insulin resistance
    108407802 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108407802 (SOCS3)
   05164 Influenza A
    108407802 (SOCS3)
   05168 Herpes simplex virus 1 infection
    108407802 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108407802 (SOCS3)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108407802 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 108407802
NCBI-ProteinID: XP_017532890
LinkDB
Position
Unknown
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSSQPVPRFDCV
LKLVHHYMPPPGAPSLPSPPTEPSSEEPEQPPAQPLPGNPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDCYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgtcctctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgcggagcccgccggcacctttctcatccgcgacagctcagaccagcgccacttcttc
acgctcagcgtcaagacccagtcggggaccaagaatctgcgcatccagtgcgaggggggc
agcttctcgctgcagagcgacccccggagctctcagccagtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggcgcgccctccctcccctcgccaccg
actgaaccctcctccgaggagccggagcagccaccggcccagccgctcccgggcaacccc
cccaggagagcctattacatctactcgggaggtgagaagatcccgctggtgctgagccgg
cccctttcctccaacgtggccactcttcaacacctctgtcggaagaccgtcaatggccac
ctggactgctatgagaaagtcacccaactgcctgggcccattcgggagttcctggaccag
tatgatgccccgctttaa

DBGET integrated database retrieval system