KEGG   Manis javanica (Malayan pangolin): 108385599
Entry
108385599         CDS       T06054                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04071  Sphingolipid signaling pathway
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04650  Natural killer cell mediated cytotoxicity
mjv04932  Non-alcoholic fatty liver disease
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    108385599 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108385599 (BID)
   04215 Apoptosis - multiple species
    108385599 (BID)
   04217 Necroptosis
    108385599 (BID)
   04115 p53 signaling pathway
    108385599 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108385599 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385599 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108385599 (BID)
   05014 Amyotrophic lateral sclerosis
    108385599 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    108385599 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108385599 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108385599 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108385599 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108385599 (BID)
   05161 Hepatitis B
    108385599 (BID)
   05160 Hepatitis C
    108385599 (BID)
   05164 Influenza A
    108385599 (BID)
   05162 Measles
    108385599 (BID)
   05168 Herpes simplex virus 1 infection
    108385599 (BID)
   05163 Human cytomegalovirus infection
    108385599 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108385599 (BID)
   05169 Epstein-Barr virus infection
    108385599 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108385599 (BID)
SSDB
Motif
Pfam: BID Bcl-2 PADR1
Other DBs
NCBI-GeneID: 108385599
NCBI-ProteinID: XP_017498584
LinkDB
Position
Unknown
AA seq 194 aa
MDPQVSNGAGLRDEHFTELLVFGFLQNCSKCNFHNELELLGHDLPQHDHLQEEQQDELQT
DGNRCSYLGREERDSENLEEIIQDIARQLAQVGDRMDRSIHPALVDHLAVQFMNVSLLEE
DRTRCLSAALEEVMQTCPKDLEEEKTVLLLAMMLAKKVADHTPSLLRGVFRTAVNFINQN
LFTYVRNLVRNRMD
NT seq 585 nt   +upstreamnt  +downstreamnt
atggaccctcaggtcagcaatggtgcaggcctccgggatgagcacttcacagagttactg
gtgtttggtttcctccaaaactgctccaagtgtaatttccacaacgagctggagctgctg
ggccacgacctgccccagcatgatcacctgcaggaggagcaacaggatgagctgcagaca
gacggcaaccggtgcagctacctggggagggaggagagagattctgagaatctagaagag
atcatccaggatattgccaggcagctcgcccaggttggggacaggatggaccgcagcatc
cacccagcgctcgtggaccacctagcagtgcagttcatgaatgtgagcctgttggaggag
gacagaacaaggtgcctctctgctgctctggaggaggtcatgcagacctgccctaaagac
ctggaggaggagaagaccgtgcttctgttggccatgatgctggccaagaaagtggctgat
cacaccccaagcctgctccgtggcgtctttcgcacagcagtgaattttattaaccagaac
ctgttcacctatgtgaggaacttagtcagaaatcggatggactga

DBGET integrated database retrieval system