KEGG   Manis javanica (Malayan pangolin): 108385633
Entry
108385633         CDS       T06054                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385633 (CACNA1E)
   04020 Calcium signaling pathway
    108385633 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108385633 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mjv04040]
    108385633 (CACNA1E)
Ion channels [BR:mjv04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108385633 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 108385633
NCBI-ProteinID: XP_017498625
LinkDB
Position
Unknown
AA seq 2454 aa
MVPEMRGPSPGRRLPEPAPYLAVGGSPEPRAPGRRRHVLALPEEEAWRPQPCALFEADAS
DEVGMLPASPRAATGFDNFFPVQEGEGPGWEGAALEAGSSPFLPVSPEVMKRRRGGLIEQ
RDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPA
AAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMIL
ATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYL
RNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMK
AMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGVLEGFDPPHPCGVQGCPAG
YECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLII
IGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLA
EENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGAS
YFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPPWLTHLLYYAEFLFL
GLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRL
LRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTP
SANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLN
VFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSLERDRRRRHHM
SMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSP
LNPLNAHPSLYRRPRPIEGLGLGLGLERCEEERVSRGGSLKGPGGNLDNQRSPLSLGKRE
PPWLARPCHGNCDPTQPEVGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSTSRSR
SASQERSLDEGVPTEGEKDHEPRGSHGGKEPTIQEEERAQGLRRTNSLMVPRGSGLAGAL
DEAHTPLVLPEPELEVGKDAALMEQEPEGSSEQALLGDVQLDMGRAISQSEPDLSCVTAN
TDKATTESTSVAVTIPDMGPLVDSTVVHISNKTDGEASPLKEAEIKEDEEEVEKPQQKKE
KRETGKAMVPHSSMFIFSTTNPIRRACHYVVNLRYFEMCILLVIAASSIALAAEDPVLTN
SERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFAL
ANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLF
MFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNII
WALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFV
ALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSAS
FEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFR
DTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWT
FVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDDESHINRHNNFRSFFGSLMLLFRS
ATGEAWQEIMLSCLGEKGCERDTTAPAGQHESERCGTDLAYVYFVSFIFFCSFLMLNLFV
AVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGK
RCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKET
LAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMF
QRMEPSSLPQEIIANAKALPYLRQDPVSGLSGHGGYPSMSPLSPQEIFQLACMEPADDGQ
FQEQQSLEPEVSELKSVQPSNHGIYLPSDTREHAGSGRASSMPRLTVDPQVMTDPGSMRR
SFSTIRDKRPNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSG
GRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPDRQGTGSLS
ESSIPSISDTSTPRRSRRQLPPIPPKPRPLLSYSSLIRHTGSISPPADGSEGSSPLAPQA
LESNDAGLAEFSNSRQAQQGQHPSPQRYISEPYLSLHEDSHASDCGEEETLTFEAAVATS
LGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGGMCGAVSDLLSDTEEDDKC
NT seq 7365 nt   +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggaccgagcccaggccgcaggctgcccgagcccgccccctac
ctggccgtgggcgggagccctgagccgcgggccccaggccgccgccgccacgtcctggcc
ctgcccgaggaggaggcatggcgcccgcagccttgtgccctgttcgaggcagatgcctcc
gacgaggtgggcatgctgccggcctccccgcgcgccgccaccggcttcgacaacttcttc
ccggtgcaggagggggagggcccgggctgggagggcgccgccctggaggcaggctccagc
cccttcctgccggtgagccccgaggtgatgaagcggcggcgtgggggcctcatcgagcag
cgagacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccggcgc
aaggagtgggagatggctcgcttcggggaggcggtggtcggcaggccagggtcgggcgat
ggagactcggaccagagcaggaaccggcaagggacccctgtgccggcctcggggccggcg
gcagcctacaagcagtcgaaagcgcagcgggcgcggactatggctttgtacaacccgatt
ccagtccggcagaactgtttcaccgtcaacagatctctgttcatcttcggagaagataac
attgtcaggaaatatgccaagaagctcatcgattggccgccatttgagtacatgatccta
gccaccatcattgccaactgcatcgtcttggccctggagcaacatcttcccgaggacgac
aagaccccaatgtcccgcagactggagaagacagaaccgtatttcattgggatcttttgc
tttgaagctgggatcaaaatcgtggccctggggttcatcttccataagggctcgtacctc
cgcaatggctggaatgtcatggacttcatcgtggtcctcagcggcatcctggccaccgca
ggaacccacttcaacacgcatgtggacctgaggaccctccgggctgtgcgtgtcctgagg
cccctgaagcttgtgtcgggcatacctagcctgcagattgtgttgaagtccatcatgaag
gccatggtgcctcttctgcagatcggccttctgctcttctttgccatcctgatgtttgct
atcattggcttggagttctacagtgggaagttgcaccgagcatgtttcatgaacaattca
ggtgttctagaaggatttgacccccctcacccatgtggtgtgcagggctgcccagccggt
tatgaatgcagggactggatcggccccaacgatgggatcacccagtttgataacatcctt
tttgctgtgctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtac
aataccaatgatgccttaggagccacctggaactggctgtacttcatccccctcatcatc
attggatccttctttgttctcaacctagtcctgggagtgctttccggggaatttgccaaa
gagagagagcgagtggagaaccggagggctttcatgaaactgcggcgccagcagcagatt
gaacgtgagctgaacgggtaccgtgcctggatagacaaagcagaggaagtcatgcttgct
gaagaaaataaaaatgctggaacatcagccttagaagtgcttcgaagggcaaccatcaaa
aggagccggacagaggccatgactcgagactccagtgatgagcactgtgttgatatctcc
tctgtgggcacacctcttgcccgagccagcatcaaaagtgcaaaagtagacggggcttcc
tacttccggcacaaggaaaggcttctgcgcatctccatccgccacatggttaaatcccag
gtgttttactggattgtgctgagcctcgtggccctcaacaccgcttgtgtggccatcgtc
catcacaaccagcccccgtggctcacgcacctcctctactatgcagaatttttgttcctg
ggactcttcctcttggagatgtccctgaagatgtacggcatggggcctcgcctttatttt
cactcctcattcaactgctttgatttcggggtcacagtgggaagtatctttgaagtggtc
tgggccatcttcagacctggtacctcttttggaatcagtgtcttgagagctctccggctt
ctaagaatatttaaaataaccaagtactgggcatccctacggaacttggtggtctccttg
atgagttccatgaagtctatcatcagtttgctgttcctcctcttcctcttcatcgttgtc
tttgctctcctaggaatgcagctatttggaggcaggtttaacttcaatgatgggacgcct
tcggcaaactttgacaccttccctgcagccatcatgactgtattccagatcctgacaggt
gaggactggaatgaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggc
atgtggtcggctatctatttcattgtgctcaccttgtttggaaactacacgctgctgaat
gtattcttggccattgctgtggacaatctggccaatgcccaggagctgaccaaggatgag
caggaagaagaggaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagc
ccgatgtctgcacccaacatgccttccctcgaaagagacagaaggagaagacaccacatg
tcgatgtgggagccacgcagcagccacctgcgggagcggaggcgccgacaccacatgtca
gtgtgggagcagcgcaccagccagctgaggaggcacatgcagatgtccagccaggaggcc
ctcaacaaagaggaggccccgcccatgaaccccctcaatcccctcaaccccttgagcccc
ctcaacccactcaatgcccaccccagcctctaccggagacccaggcccatcgagggcctg
ggcctgggcctaggcctcgagagatgcgaggaggagcgtgtcagccgcggggggtccctc
aaggggcctggagggaacctggacaaccagaggagccccttgtcgcttggcaaacgggag
ccgccgtggctggccaggccctgccacgggaactgtgacccgacccagccggaggttggg
ggcggggagaccgtggtgaccttcgaggaccgggccaggcacaggcagagccagcggcgc
agccggcaccgccgggtcaggacggaaggcaaggagccctcctccacctcccggagcagg
tctgccagccaggagcggagtctggatgaaggcgtgcccaccgagggggagaaggaccac
gagcccaggggcagccacgggggcaaggagcccaccatccaggaagaagagagagcccag
ggcctgaggaggaccaacagtctgatggtgcccagaggctccgggctggcaggggccctc
gatgaggcccacacacccctcgtcctgcctgaaccagagctggaagtggggaaggatgcg
gcgctgatggagcaggagccggagggcagcagcgagcaagccctgctgggggatgtgcag
cttgacatgggccgggccatcagccagagtgagcccgacctctcctgcgtcacggccaat
acggacaaggccaccactgagagcaccagcgtcgccgtcaccatccccgacatgggcccg
ttggtggactcgaccgtggtgcacattagtaacaagaccgatggagaagccagtcccttg
aaggaggcagagatcaaagaggatgaggaagaggtggagaagccacagcagaagaaggag
aaacgtgagacaggcaaagccatggtgccccacagctcgatgttcatcttcagcaccacc
aacccgatccgccgggcctgccactacgtcgtgaacctgcgctactttgagatgtgcatt
ctcctggtgattgcagccagcagcatcgccctggcagccgaggaccccgtcctgaccaac
tcggagcgcaacaaagtcctgaggtacttcgactatgttttcactggcgtgttcaccttt
gagatggtgataaagatgatagaccagggcttgatcctgcaggatggctcctacttccga
gacctgtggaacatcctggactttgtggtggtggtcggagcgttggtggccttcgctttg
gcgaacgctttgggaaccaacaagggccgggacatcaagaccatcaaatccctccgggtg
ctccgagtcctgaggccgctgaagaccatcaagcgcctgcccaagctgaaggctgtgttt
gactgtgtggtcacctccttgaagaatgtcttcaacatactcattgtctacaagctcttc
atgttcatctttgccgtcatcgcagtgcagcttttcaaggggaagttcttctactgcaca
gacagctccaaggacacagagaaggagtgcataggcaactatgtagatcacgagaaaaat
aagatggaggtgaaaggccgggaatggaagcgccatgagttccactacgacaacattatc
tgggccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagtcttgcag
cattctgtcgatgtgaccgaggaagaccgaggtccgagccgcagcaaccgcatggagatg
tccatcttttacgtggtctactttgtggtcttccctttcttcttcgtcaatatcttcgtg
gctctcatcatcatcacgttccaggagcaaggggacaagatgatggaggagtgcagcctg
gagaagaacgagagggcgtgcatcgactttgccatcagtgccaagcccctcacccgctac
atgccacagaacaggcacaccttccagtaccgcgtgtggcactttgtggtgtctgcctcc
tttgagtacaccatcatggccatgatcgccttgaacaccgtcgtgctgatgatgaagtac
tactcagctccctgcacctatgaactggctctgaagtacctgaacatcgccttcactatg
gtgttctccctggagtgtgtcctcaagatcattgcgtttggcttcctgaactatttccga
gacacctggaatatctttgacttcatcaccgtgatcggcagtatcacagaaattattctg
acagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctgttccga
gctgcccgcctcatcaagctcctgcgtcagggctatactatccgtattttactttggacc
ttcgtgcagtcctttaaggccctcccctatgtctgccttttgattgccatgcttttcttc
atctatgccatcatcgggatgcaggtatttggcaacataaaattagatgacgagagtcac
atcaaccggcacaacaacttccgcagtttcttcgggtccctcatgttactcttcaggagt
gccaccggggaggcctggcaggagataatgctttcgtgccttggggagaaaggctgtgag
cgggacaccaccgccccggcaggacagcacgagagcgagcgctgcggtaccgacctggcc
tatgtttactttgtctccttcatcttcttctgctccttcctgatgctcaacctgtttgtg
gctgtcatcatggacaactttgaatacctgacgcgggactcctccatcctgggacctcac
cacttggatgagtttgtccgtgtctgggcagaatatgacagagctgcatgtggccgcatc
cattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaag
agatgtccctccaaagtggcatataagaggttggtcctaatgaatatgccagtagctgag
gacatgactgtccacttcacctccacccttatggctctgatccggacggctctggacatc
aaaattgccaaaggaggtgcagacaggcagcagctagactcggagctgcaaaaggagacc
ctggccatctggcctcacctgtcccagaagatgctagatctgcttgtgcccatgcccaaa
gcctctgacctaaccgtgggcaaaatctatgcagcaatgatgatcatggactactataaa
cagagtaaggtgaagaaacagaggcagcagctggaagagcagaaaaatgcacccatgttc
cagcgcatggagccctcatccctgccccaggagattatcgctaatgccaaagccctgcct
tatctccggcaggaccccgtttcaggcctgagtggccatggcggatatccttcgatgagt
ccactctccccccaggaaatattccagttggcctgtatggaaccagccgatgatgggcag
ttccaggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagccctct
aaccatggcatctaccttccttcggacacccgggagcatgcgggatctgggagggcatcc
tctatgccacgcctgactgtggatccccaggtgatgacggaccctggctccatgagacgt
tcattttccactattcgggataaacgtccaaattcttcgtggctggaggaattctccatg
gagagaagcagtgaaaacacctacaagtctcgtcgccggagttaccactcctctctgagg
ctgtcggcccatcgcctgaactctgactcaggccacaagtccgacacccaccgctccggg
ggcagagagcggggccgatcaaaagagcggaagcatcttctctctcccgatgtctcccgc
tgcaactccgaggagcgagggacccaggccgactgggagtccccagagcgccggcagtcc
aggtctcccagtgagggcaggtcacagacccctgacagacagggcacgggctccctgagt
gaaagctccatcccctctatctctgacaccagcaccccacgacgaagtcgccggcagctc
ccacccatccctccgaagcctcggccccttctttcctacagctccctgatacgacacact
gggagcatctctccacccgctgacgggagcgagggcagctccccactggctccccaagct
ctggagagcaacgacgctggcctggccgagttttccaactccaggcaggcacagcagggc
caacacccctccccacagcgttacatctctgagccctacctgtccctgcacgaagactcc
catgcctcggactgtggcgaggaggagacgctcaccttcgaagctgcagtggccaccagc
ctgggccggtccaacaccatcggctcagccccgcccctgcggcacagctggcagatgccc
aacgggcactaccggcggcggaggcgtggggggccagggccgggcgggatgtgtggcgct
gtcagcgacctcctgagtgacacagaagaagatgacaaatgctag

DBGET integrated database retrieval system