KEGG   Manis javanica (Malayan pangolin): 108385648
Entry
108385648         CDS       T06054                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04062  Chemokine signaling pathway
mjv04068  FoxO signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
mjv05034  Alcoholism
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385648 (SOS1)
   04012 ErbB signaling pathway
    108385648 (SOS1)
   04014 Ras signaling pathway
    108385648 (SOS1)
   04630 JAK-STAT signaling pathway
    108385648 (SOS1)
   04068 FoxO signaling pathway
    108385648 (SOS1)
   04072 Phospholipase D signaling pathway
    108385648 (SOS1)
   04151 PI3K-Akt signaling pathway
    108385648 (SOS1)
   04150 mTOR signaling pathway
    108385648 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385648 (SOS1)
   04540 Gap junction
    108385648 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108385648 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108385648 (SOS1)
   04660 T cell receptor signaling pathway
    108385648 (SOS1)
   04662 B cell receptor signaling pathway
    108385648 (SOS1)
   04664 Fc epsilon RI signaling pathway
    108385648 (SOS1)
   04062 Chemokine signaling pathway
    108385648 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108385648 (SOS1)
   04912 GnRH signaling pathway
    108385648 (SOS1)
   04915 Estrogen signaling pathway
    108385648 (SOS1)
   04917 Prolactin signaling pathway
    108385648 (SOS1)
   04926 Relaxin signaling pathway
    108385648 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    108385648 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108385648 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    108385648 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385648 (SOS1)
   05206 MicroRNAs in cancer
    108385648 (SOS1)
   05205 Proteoglycans in cancer
    108385648 (SOS1)
   05231 Choline metabolism in cancer
    108385648 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108385648 (SOS1)
   05225 Hepatocellular carcinoma
    108385648 (SOS1)
   05226 Gastric cancer
    108385648 (SOS1)
   05214 Glioma
    108385648 (SOS1)
   05221 Acute myeloid leukemia
    108385648 (SOS1)
   05220 Chronic myeloid leukemia
    108385648 (SOS1)
   05211 Renal cell carcinoma
    108385648 (SOS1)
   05215 Prostate cancer
    108385648 (SOS1)
   05213 Endometrial cancer
    108385648 (SOS1)
   05224 Breast cancer
    108385648 (SOS1)
   05223 Non-small cell lung cancer
    108385648 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    108385648 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108385648 (SOS1)
   05160 Hepatitis C
    108385648 (SOS1)
   05163 Human cytomegalovirus infection
    108385648 (SOS1)
   05165 Human papillomavirus infection
    108385648 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385648 (SOS1)
   01522 Endocrine resistance
    108385648 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mjv04990]
    108385648 (SOS1)
Domain-containing proteins not elsewhere classified [BR:mjv04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   108385648 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 108385648
NCBI-ProteinID: XP_017498645
LinkDB
Position
Unknown
AA seq 1348 aa
MVRMXHPSSDCGNGGSRSHVHCKLRSYTDAVMPVLLMRCAVGQWVQGQVHPTLESSDDAL
QYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSL
PVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVA
MCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKV
FREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGLIEDTVEMTDEGSPHPLVGSCFED
LAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLA
PVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESAC
RFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFD
GLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVI
FSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEEN
IIFEENTQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLII
ERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFE
RDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHI
SRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMI
RHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYR
LDHTFEQIASRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNP
EVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGSSMEKEF
TDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISY
SRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVT
LPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPR
QPTSKAYSPRYSISDRTSLSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHG
NAFFPNSTSSFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKL
PPKTYKREPTHPCMHRDGPPLLENAHSS
NT seq 4047 nt   +upstreamnt  +downstreamnt
atggtgagaatgangcaccctagcagtgactgcgggaacggagggtcccgatcccatgta
cactgtaaacttcgctcatacactgatgctgtcatgcccgttctgctaatgcgatgtgct
gttggtcagtgggtccaggggcaagttcatcctactcttgagtctagtgatgatgctctt
cagtatgttgaagaattaattttgcagttattaaatatgctgtgccaagctcagccccga
agtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcatccaattgataagtgg
gcaatagctgatgcccaatcggctattgaaaagaggaagcgaagaaaccctttatctctc
ccagtagaaaaaattcatcctttattaaaggaggtcctaggttataaaattgatcaccag
gtttctgtttacatagtagcagtattagaatacatttctgcagatattttaaagctggtt
ggaaattatgtacgaaatatacggcattatgaaattacaaaacaagatattaaagtagca
atgtgtgctgataaggtattgatggatatgtttcatcaagatgtagaagatatcaatata
ttatctttaactgatgaagagccttccacctcaggagagcaaacttactatgatttggta
aaagcatttatggcagaaattcgacaatacataagggaactaaatttaattataaaagtt
tttagagagccctttgtctccaattcaaaattgttttctgctaacgatgtagaaaatata
tttagtcgtatagtagatatacatgaacttagtgtaaagttactgggccttatagaggat
actgtagaaatgaccgatgaaggcagtccccatccgttagtaggaagctgcttcgaagac
ttagcagaggaactggcgtttgatccatatgaatcatatgcccgggatattctacggcct
ggctttcatgatcgtttcctcagtcagctatcaaagcctggagcggcactctatttgcag
tcaataggcgaaggtttcaaagaagctgttcaatatgttttaccaaggctacttctagcc
cctgtttaccactgtctccattactttgaacttctgaagcagttagaagaaaagagtgaa
gatcaagaagacaaggaatgtttgaaacaagcaataacagctttgcttaatgttcagagt
ggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactgagtgaatctgcatgt
cgtttttatagtcagcaaatgaaggggaaacaactagcaatcaagaaaatgaatgagatt
cagaagaatattgatggttgggagggaaaagacattggacagtgttgcaatgagtttata
atggaaggaactcttacacgtgtaggagccaaacatgagagacacatatttctctttgat
ggcttaatgatttgctgtaaatcaaatcatgggcagccaagacttcctggtgctagcaat
gcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaaattaatgacaaagat
gacaccagtgagtacaagcatgcttttgaaataattttaaaagatgaaaatagtgttata
ttttctgccaagtcagctgaagagaagaacaactggatggcagcattgatatctttacag
taccggagtacactagaaaggatgcttgatgtgacaatgctccaggaagagaaggaggag
cagatgaggctccctagtgctgatgtttatagatttgcagagcctgactctgaagagaat
ataatatttgaagaaaacacgcagcccaaggctggaattccaattatcaaagcaggaact
gttattaaacttatagaaaggcttacataccatatgtatgcagatcccaattttgttcgg
acatttcttacaacatacagatccttttgtaaacctcaagaactactgagtcttataata
gaaaggtttgaaattccagagcctgagccaacagaagctgatcgcatagctatagagaat
ggagatcaacccttgagtgcagaactaaaaaggtttagaaaagaatatatacagcctgta
caactgcgagtattaaatgtatgtcgacattgggtagaacaccacttctatgattttgaa
agagatgcagatcttttgcagcgaatggaggaatttattggaacagtaagaggtaaagca
atgaaaaaatgggttgaatccatcactaaaataatccaaaggaaaaaaattgcaagagac
aatggaccaggtcataatattacatttcagagttcacctcccacagtggagtggcatata
agccgacctgggcacatagagacttttgacctgctcaccttacacccaatagaaattgct
cgacaactcactttacttgaatcagatctatatcgagctgtacagccatctgaattagtt
gggagtgtatggacaaaagaagataaagaaattaattctcctaatcttctgaaaatgatc
cggcacaccactaatctcacgctatggtttgagaaatgtattgtagaaacggaaaactta
gaagaaagagtagctgtggtgagtcgaataattgagattctgcaagtctttcaagagctg
aacaacttcaatggcgtccttgaggttgtcagcgctatgaactcatcacctgtttacaga
ctagaccacacattcgagcaaatagcaagtcgccaaaagaaaattttagaagaagctcat
gaattaagtgaagatcactataagaaatatttggcaaaactcaggtctattaatccacca
tgtgtgcctttctttggaatttatctaactaatattttgaaaacagaagaaggcaaccct
gaggtcctaaagaggcacggaaaagagcttataaactttagcaaaaggaggaaagtagca
gaaataacaggagaaatccagcagtaccaaaatcagccttactgtttacgagtagaatca
gatatcaaaaggttctttgaaaacttgaatccaatgggaagtagcatggaaaaagaattt
acagattatcttttcaacaaatccctagaaatagaaccacgaaaccctaaacctctccca
agatttccaaaaaaatatagctatcccctaaaatctcctggtgttcgtccatcaaaccca
agaccaggtaccatgagacaccccacacctctgcagcaggagccacggaaaattagttat
agtaggatccctgaaagtgagacggaaagtacagcatctgctccaaattctccaaggaca
ccgttaacacctcctcctgcttctggggcttccagtaccacagatgtttgcagtgtcttt
gattctgatcattcgagcccttttcattcaagcagcgataccgtctttatccaagttaca
ctgccccatggcccaagatctgcttcagtttcatctataagtttaaccaagggcactgat
gaagtgcctgtcccccctcctgttcctccacgaagacgaccagaatctgccccagcggaa
tcttcgccatctaagattatgtctaagcatttggacagccccccagcaattcctcctagg
caacccacatcaaaagcatactcaccacgatactcgatatcagaccggacctctctatca
gaccctcctgaaagccctcccttattaccaccacgagaacctgtgaggacacctgatgtt
ttctcaagctcaccactacatctccaacctccccctttgggcaaaaaaagtgatcatggc
aatgccttcttcccaaatagcacttcctcttttacaccaccacctcctcaaacaccttct
cctcatggcacaagaaggcatctgccatcaccaccattaacacaagaagtggaccttcat
tctattgctgggccacctgttcctccacgacaaagcacttctcagcatatccctaaactc
cctccaaaaacgtataaaagggagcccacacacccatgcatgcacagagacgggccaccg
ctgttggagaatgctcattcttcctga

KEGG   Manis javanica (Malayan pangolin): 108391894
Entry
108391894         CDS       T06054                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04062  Chemokine signaling pathway
mjv04068  FoxO signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
mjv05034  Alcoholism
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108391894 (SOS2)
   04012 ErbB signaling pathway
    108391894 (SOS2)
   04014 Ras signaling pathway
    108391894 (SOS2)
   04630 JAK-STAT signaling pathway
    108391894 (SOS2)
   04068 FoxO signaling pathway
    108391894 (SOS2)
   04072 Phospholipase D signaling pathway
    108391894 (SOS2)
   04151 PI3K-Akt signaling pathway
    108391894 (SOS2)
   04150 mTOR signaling pathway
    108391894 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108391894 (SOS2)
   04540 Gap junction
    108391894 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108391894 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108391894 (SOS2)
   04660 T cell receptor signaling pathway
    108391894 (SOS2)
   04662 B cell receptor signaling pathway
    108391894 (SOS2)
   04664 Fc epsilon RI signaling pathway
    108391894 (SOS2)
   04062 Chemokine signaling pathway
    108391894 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108391894 (SOS2)
   04912 GnRH signaling pathway
    108391894 (SOS2)
   04915 Estrogen signaling pathway
    108391894 (SOS2)
   04917 Prolactin signaling pathway
    108391894 (SOS2)
   04926 Relaxin signaling pathway
    108391894 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    108391894 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108391894 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    108391894 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108391894 (SOS2)
   05206 MicroRNAs in cancer
    108391894 (SOS2)
   05205 Proteoglycans in cancer
    108391894 (SOS2)
   05231 Choline metabolism in cancer
    108391894 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108391894 (SOS2)
   05225 Hepatocellular carcinoma
    108391894 (SOS2)
   05226 Gastric cancer
    108391894 (SOS2)
   05214 Glioma
    108391894 (SOS2)
   05221 Acute myeloid leukemia
    108391894 (SOS2)
   05220 Chronic myeloid leukemia
    108391894 (SOS2)
   05211 Renal cell carcinoma
    108391894 (SOS2)
   05215 Prostate cancer
    108391894 (SOS2)
   05213 Endometrial cancer
    108391894 (SOS2)
   05224 Breast cancer
    108391894 (SOS2)
   05223 Non-small cell lung cancer
    108391894 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    108391894 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108391894 (SOS2)
   05160 Hepatitis C
    108391894 (SOS2)
   05163 Human cytomegalovirus infection
    108391894 (SOS2)
   05165 Human papillomavirus infection
    108391894 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108391894 (SOS2)
   01522 Endocrine resistance
    108391894 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mjv04990]
    108391894 (SOS2)
Domain-containing proteins not elsewhere classified [BR:mjv04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   108391894 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 108391894
NCBI-ProteinID: XP_017507258
LinkDB
Position
Unknown
AA seq 1272 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFRETFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVTLHFQSIADGFKEAVRYVLPRLLLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALLNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
CSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENNIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSVIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKTMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDIMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETEVESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNLKSDDDPPAIPPRQPPPPKVKPRVPAPTGSFDASL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQLPPLGHLHRDPDWFRDISTCPNSPN
TPPSTPSPRIPRRCYVLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSY
RLPLLENAETPQ
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataagtgggctattgctgatgcacaatctgccatagagaaacgaaaacgaaga
aatcctcttttattgcctgtggacaaaatccatccttcattgaaggaagtcttaggatat
aaagtggactaccatgtgtccctatatattgtggctgtactggagtatatctcagctgat
attctgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagatgaacctagttcttcaggtgaactaaactattat
gaccttgtcagaactgaaattgcagaagaaagacagtatctgcgggaactaaatatgatc
ataaaagtgtttcgagaaacctttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacatctcagacatacatgaattgactgtgaaactcctaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaggatctggcagaggagcaagcatttgatccttatgaaacattatcacaggacatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtgactcta
cactttcagtccattgctgatggttttaaagaggcagttcgttacgtccttccacgcctt
ttgctggtgccagtatatcattgttggcactattttgaattattaaagcaactgaaagca
tgtagtgaagagcaagaagacagagaatgtttgaaccaagctattactgctctcttgaat
ctccaaggtagtatggatcgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggaaggtccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgatggcttaatgattagctgtaaacccaatcatagccagtctcgccttccaggt
tgcagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatttgt
gataaagaagatacatgtgagtgcaaacatgcttttgaattagtatccaaagatgaaaac
aacataatatttgctgcaaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattattgaaagaagaa
aatgagcaaccactgagattgccaagtcctgaagtgtatcgctttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcagagtagaagtgtaatccccattattaaa
ggaggaaccgtggtgaaattaattgagaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggtgaacagccaatcagtgcagaccttaaaagatttcgcaaggaatacgtc
caacccgtacaacttagggtcttaaatgtttttcggcactgggttgaacaccatttttat
gactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaaacaatgaagaaatgggtagagtcaattgctaagattatcaagaggaaaaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtcctcctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatatcatgacacttcatcccata
gaaattgcacgtcagctgacacttttggaatctgacctctacaggaaagttcaaccttct
gaactcgtagggagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccatactacaaatctcaccctttggtttgaaaaatgcattgtggaagca
gaaaattttgaggaacgtgtggcagtactaagtagaattatagagattctgcaagttttt
caagatttgaataatttcaatggtgtactggagatagtcagtgcagtaaattcagtgtca
gtatacagattagatcatacgtttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacttagtaaaacttaagtctatc
aatccaccttgtgtgcctttttttggaatatacttaacaaatattctgaagactgaagaa
gggaataacgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcaacagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggaatttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctagaaaatcaactttttctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacgtcaggcactttgcgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagcaggattgctgaaactgaggttgaatcaacagtg
tcagccccaacctctccaaatacaccatctactccacctgtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaagtctttcttcagttcctgtggtagtttacataaactaagt
gaagagccactgattcctcctccactgccacctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatctgaaatctgatgatgatcccccagctattccaccaagacaacct
ccccctccaaaggtaaaacccagagttcctgctcctactggttcatttgatgcatctctg
cacagtccacctccaccaccaccaagagatcctcttccggatacccctccaccggttccc
cttcggcctccagaacactttataaactgtccgtttaatcttcagctgcctccactggga
catcttcacagagatccagattggttcagagatatcagtacatgtccaaattcgccaaat
actcctcctagcacaccctctcctaggataccacgtcgatgctatgtgctcagttctagt
cacaataatcttgctcatcctcaagctcctcctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccccccatcgtat
agactgcctttgctggaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system