KEGG   Manis javanica (Malayan pangolin): 108385666
Entry
108385666         CDS       T06054                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04062  Chemokine signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04071  Sphingolipid signaling pathway
mjv04150  mTOR signaling pathway
mjv04270  Vascular smooth muscle contraction
mjv04310  Wnt signaling pathway
mjv04370  VEGF signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04613  Neutrophil extracellular trap formation
mjv04650  Natural killer cell mediated cytotoxicity
mjv04662  B cell receptor signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04670  Leukocyte transendothelial migration
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04727  GABAergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04916  Melanogenesis
mjv04918  Thyroid hormone synthesis
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04925  Aldosterone synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04931  Insulin resistance
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv04960  Aldosterone-regulated sodium reabsorption
mjv04961  Endocrine and other factor-regulated calcium reabsorption
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv04973  Carbohydrate digestion and absorption
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05032  Morphine addiction
mjv05140  Leishmaniasis
mjv05143  African trypanosomiasis
mjv05146  Amoebiasis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385666 (PRKCB)
   04012 ErbB signaling pathway
    108385666 (PRKCB)
   04014 Ras signaling pathway
    108385666 (PRKCB)
   04015 Rap1 signaling pathway
    108385666 (PRKCB)
   04310 Wnt signaling pathway
    108385666 (PRKCB)
   04370 VEGF signaling pathway
    108385666 (PRKCB)
   04064 NF-kappa B signaling pathway
    108385666 (PRKCB)
   04066 HIF-1 signaling pathway
    108385666 (PRKCB)
   04020 Calcium signaling pathway
    108385666 (PRKCB)
   04070 Phosphatidylinositol signaling system
    108385666 (PRKCB)
   04071 Sphingolipid signaling pathway
    108385666 (PRKCB)
   04150 mTOR signaling pathway
    108385666 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385666 (PRKCB)
   04540 Gap junction
    108385666 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108385666 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    108385666 (PRKCB)
   04662 B cell receptor signaling pathway
    108385666 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    108385666 (PRKCB)
   04670 Leukocyte transendothelial migration
    108385666 (PRKCB)
   04062 Chemokine signaling pathway
    108385666 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    108385666 (PRKCB)
   04929 GnRH secretion
    108385666 (PRKCB)
   04912 GnRH signaling pathway
    108385666 (PRKCB)
   04921 Oxytocin signaling pathway
    108385666 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    108385666 (PRKCB)
   04918 Thyroid hormone synthesis
    108385666 (PRKCB)
   04919 Thyroid hormone signaling pathway
    108385666 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    108385666 (PRKCB)
   04916 Melanogenesis
    108385666 (PRKCB)
   04925 Aldosterone synthesis and secretion
    108385666 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108385666 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    108385666 (PRKCB)
   04971 Gastric acid secretion
    108385666 (PRKCB)
   04972 Pancreatic secretion
    108385666 (PRKCB)
   04973 Carbohydrate digestion and absorption
    108385666 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108385666 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108385666 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    108385666 (PRKCB)
   04727 GABAergic synapse
    108385666 (PRKCB)
   04725 Cholinergic synapse
    108385666 (PRKCB)
   04728 Dopaminergic synapse
    108385666 (PRKCB)
   04726 Serotonergic synapse
    108385666 (PRKCB)
   04720 Long-term potentiation
    108385666 (PRKCB)
   04730 Long-term depression
    108385666 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    108385666 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108385666 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108385666 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385666 (PRKCB)
   05206 MicroRNAs in cancer
    108385666 (PRKCB)
   05205 Proteoglycans in cancer
    108385666 (PRKCB)
   05231 Choline metabolism in cancer
    108385666 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108385666 (PRKCB)
   05214 Glioma
    108385666 (PRKCB)
   05223 Non-small cell lung cancer
    108385666 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108385666 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    108385666 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    108385666 (PRKCB)
   05032 Morphine addiction
    108385666 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108385666 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108385666 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108385666 (PRKCB)
   05161 Hepatitis B
    108385666 (PRKCB)
   05171 Coronavirus disease - COVID-19
    108385666 (PRKCB)
   05164 Influenza A
    108385666 (PRKCB)
   05163 Human cytomegalovirus infection
    108385666 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108385666 (PRKCB)
   05140 Leishmaniasis
    108385666 (PRKCB)
   05143 African trypanosomiasis
    108385666 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385666 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108385666 (PRKCB)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108385666 (PRKCB)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108385666 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 108385666
NCBI-ProteinID: XP_017498662
LinkDB
Position
Unknown
AA seq 544 aa
MTQPEESAMGGARGAGVLIHRPPERCHRTQGNGVRSGPGGPPTPGEGLLIRDAKNLVPMD
PNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDW
DLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEELRQKFER
AKISQGTKAPEEKTINTISKLDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDEL
YAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGD
LMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGM
CKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDED
ELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEK
LERKEIQPPYKPKARDKRDTSNFDKEFTRQPVGLTPTDKLFIMNLDQNEFAGFSYTNPEF
VINV
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgacccagccggaggaaagtgccatgggtggtgcccgtggggcaggtgttctgatccac
aggccaccggaaaggtgtcacagaacccaaggaaatggagttcgttctggcccaggaggg
ccaccgacccctggcgagggcttgcttataagagatgctaagaaccttgtacctatggac
cccaatggtttgtcagatccctatgtgaaactgaaactgattcctgatcccaaaagtgag
agcaagcagaagaccaagaccatcaagtgctccctcaaccctgaatggaatgaaacattt
agattccagctgaaagaatctgacaaagacagaagactgtctgtagagatttgggactgg
gatctgaccagcaggaatgactttatggggtctttgtcatttgggatttctgaactccag
aaagctggtgttgatggctggtttaagttactgagccaggaggaaggtgagtacttcaat
gtgcctgtgccaccagaaggaggtgagggcaatgaagaactgcggcagaaatttgagagg
gccaagatcagtcaggggactaaggctccagaagaaaagacaatcaacaccatatccaag
cttgacaacaacgggaacagggatcggatgaaactgaccgactttaacttcctgatggtg
ctcgggaaaggcagctttggcaaggtcatgctctcagagcgcaaggggacagatgagctg
tatgctgtgaagatcctgaagaaggatgtcgtgatccaggatgacgatgtggaatgcacg
atggtggagaagagggtgctggccctgcccgggaagccgccattcctgacccagctccat
tcctgcttccagaccatggaccgcctgtactttgtgatggagtacgtgaatgggggtgac
ctcatgtaccacatccaacaagttggccggtttaaggagcctcatgccgtattttacgct
gcagaaatcgccattggtctattcttcttgcagagcaagggcatcatttaccgtgaccta
aaacttgacaatgtgatgctggattcagagggccacatcaagattgcggattttggtatg
tgtaaggaaaacatctgggatggggtgacaaccaagacattctgcggcactccggactac
attgcccccgagataattgcttatcagccctatgggaagtccgtggactggtgggcattt
ggagtcctgctgtatgaaatgttggctgggcaggcaccctttgaaggggaggatgaggat
gaactcttccagtccatcatggaacacaacgtggcttatccaaagtccatgtccaaggaa
gctgtggccatctgtaaagggctgatgacaaaacacccaggcaaacgtctgggctgtggg
cccgaaggcgaacgtgacatcaaagagcatgcgtttttccggtatattgattgggagaaa
cttgaacgcaaagagattcagcccccgtataagccaaaagccagggacaagcgagacacc
tccaacttcgacaaagagttcaccaggcagcctgtgggactcacacctaccgacaaactc
ttcatcatgaacttggaccaaaatgaatttgctggcttctcctataccaatccagagttt
gtcattaatgtgtag

KEGG   Manis javanica (Malayan pangolin): 108387768
Entry
108387768         CDS       T06054                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04270  Vascular smooth muscle contraction
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04613  Neutrophil extracellular trap formation
mjv04650  Natural killer cell mediated cytotoxicity
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04670  Leukocyte transendothelial migration
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04727  GABAergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04916  Melanogenesis
mjv04918  Thyroid hormone synthesis
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04925  Aldosterone synthesis and secretion
mjv04926  Relaxin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv04960  Aldosterone-regulated sodium reabsorption
mjv04961  Endocrine and other factor-regulated calcium reabsorption
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05032  Morphine addiction
mjv05143  African trypanosomiasis
mjv05146  Amoebiasis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108387768 (PRKCA)
   04012 ErbB signaling pathway
    108387768 (PRKCA)
   04014 Ras signaling pathway
    108387768 (PRKCA)
   04015 Rap1 signaling pathway
    108387768 (PRKCA)
   04310 Wnt signaling pathway
    108387768 (PRKCA)
   04370 VEGF signaling pathway
    108387768 (PRKCA)
   04066 HIF-1 signaling pathway
    108387768 (PRKCA)
   04020 Calcium signaling pathway
    108387768 (PRKCA)
   04070 Phosphatidylinositol signaling system
    108387768 (PRKCA)
   04072 Phospholipase D signaling pathway
    108387768 (PRKCA)
   04071 Sphingolipid signaling pathway
    108387768 (PRKCA)
   04151 PI3K-Akt signaling pathway
    108387768 (PRKCA)
   04150 mTOR signaling pathway
    108387768 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108387768 (PRKCA)
   04540 Gap junction
    108387768 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108387768 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    108387768 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    108387768 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    108387768 (PRKCA)
   04670 Leukocyte transendothelial migration
    108387768 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    108387768 (PRKCA)
   04929 GnRH secretion
    108387768 (PRKCA)
   04912 GnRH signaling pathway
    108387768 (PRKCA)
   04921 Oxytocin signaling pathway
    108387768 (PRKCA)
   04926 Relaxin signaling pathway
    108387768 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    108387768 (PRKCA)
   04918 Thyroid hormone synthesis
    108387768 (PRKCA)
   04919 Thyroid hormone signaling pathway
    108387768 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    108387768 (PRKCA)
   04916 Melanogenesis
    108387768 (PRKCA)
   04925 Aldosterone synthesis and secretion
    108387768 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108387768 (PRKCA)
   04270 Vascular smooth muscle contraction
    108387768 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    108387768 (PRKCA)
   04971 Gastric acid secretion
    108387768 (PRKCA)
   04972 Pancreatic secretion
    108387768 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108387768 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108387768 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    108387768 (PRKCA)
   04727 GABAergic synapse
    108387768 (PRKCA)
   04725 Cholinergic synapse
    108387768 (PRKCA)
   04728 Dopaminergic synapse
    108387768 (PRKCA)
   04726 Serotonergic synapse
    108387768 (PRKCA)
   04720 Long-term potentiation
    108387768 (PRKCA)
   04730 Long-term depression
    108387768 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    108387768 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108387768 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    108387768 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108387768 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108387768 (PRKCA)
   05206 MicroRNAs in cancer
    108387768 (PRKCA)
   05205 Proteoglycans in cancer
    108387768 (PRKCA)
   05231 Choline metabolism in cancer
    108387768 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108387768 (PRKCA)
   05214 Glioma
    108387768 (PRKCA)
   05223 Non-small cell lung cancer
    108387768 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108387768 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    108387768 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    108387768 (PRKCA)
   05032 Morphine addiction
    108387768 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108387768 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108387768 (PRKCA)
   05161 Hepatitis B
    108387768 (PRKCA)
   05171 Coronavirus disease - COVID-19
    108387768 (PRKCA)
   05164 Influenza A
    108387768 (PRKCA)
   05163 Human cytomegalovirus infection
    108387768 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108387768 (PRKCA)
   05143 African trypanosomiasis
    108387768 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108387768 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108387768 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108387768 (PRKCA)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108387768 (PRKCA)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108387768 (PRKCA)
Membrane trafficking [BR:mjv04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    108387768 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C Kinase-like C1_2 APH
Other DBs
NCBI-GeneID: 108387768
NCBI-ProteinID: XP_017501615
LinkDB
Position
Unknown
AA seq 580 aa
MPAKDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCG
MDHTEKRGRIYLKAQVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKT
KTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPAS
GWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRRQPSNNLD
RVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLA
LLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLF
FLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMNGVTTRTFCGTPDYIAPEIIAY
QPYAKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGL
MTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTR
GQPVLTPPDQLVIANIDQSDFEGFSYVNPQFIHPILQSAV
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgccagcgaaggaccccaggagcaagcacaagtttaaaatccacacttatggaagcccc
accttctgtgaccactgtgggtcattgttgtatggccttatccatcaagggatgaaatgt
gacacctgtgatatgaatgtgcacaagcagtgtgtgatcaacgtgcccagcctctgtggg
atggaccacacggagaagagggggcggatctacctgaaggcccaggtggccgatgaaaag
ctccatgtcacagtgcgagatgcaaaaaatctaatccctatggatccaaacgggctttca
gatccttacgtgaagctgaaacttattcctgaccccaagaatgaaagcaaacaaaaaacc
aaaaccatccgttccacgctgaacccccagtggaatgagtcctttacgttcaaattaaaa
ccttcagataaagaccgacgactgtctgtagaaatctgggactgggatagaaccaccagg
aacgacttcatggggtccctctcctttggagtttcggagctgatgaagatgccagccagc
ggatggtacaagctgcttaaccaagaagagggggagtactacaatgtgcccattccagaa
ggggatgaagaaggaaacatggagctccggcagaaattcgagaaagccaagcttggccct
gctggtaacaaagtgatcagtccttcagaagacaggaggcagccttccaacaaccttgac
agagtgaaactcacagacttcaacttcctcatggtgctggggaaggggagtttcggcaag
gtgatgcttgctgacaggaagggaacagaagaactgtacgctatcaaaatcctcaagaag
gacgtggtgattcaagacgacgacgtggagtgcaccatggtggaaaagcgagtcctggct
ctgctcgacaagccgcctttcctgacccagctgcactcctgcttccagacagtggatcgg
ctgtacttcgtcatggaatatgtcaacggcggggacctcatgtaccacatccagcaagta
ggaaagtttaaggaaccacaagcagtattctatgcagcggagatttccattggattgttc
ttcctccataaaagaggcatcatttatagggatctgaagttagataatgtgatgctggat
tcagaaggacatatcaagattgctgattttgggatgtgcaaggaacacatgatgaatgga
gtcacaaccaggaccttctgtgggactccagattacattgccccagagataatcgcttat
cagccgtatgcaaaatccgtggactggtgggcctttggcgtcctcttatatgaaatgcta
gctgggcagcctccattcgacggtgaagatgaagatgagctgtttcagtctataatggag
cacaacgtttcttatccaaaatccttgtccaaggaggctgtttccatctgcaaaggactc
atgaccaagcacccaggcaagcggctgggctgtgggcccgagggagagagggacgtgcga
gaacacgccttcttccggaggatcgactgggagaaactggagaacagggagatccagcca
ccattcaagcccaaagtgtgtggcaaaggagcggaaaactttgacaagttcttcacacgg
gggcagcctgtcttaacgccgccggatcagctggtcatcgctaacatcgaccagtccgat
tttgaagggttctcgtatgtcaatcctcagtttatacaccccatcttacagagcgcggta
tga

KEGG   Manis javanica (Malayan pangolin): 108395733
Entry
108395733         CDS       T06054                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04071  Sphingolipid signaling pathway
mjv04150  mTOR signaling pathway
mjv04270  Vascular smooth muscle contraction
mjv04310  Wnt signaling pathway
mjv04370  VEGF signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04613  Neutrophil extracellular trap formation
mjv04650  Natural killer cell mediated cytotoxicity
mjv04666  Fc gamma R-mediated phagocytosis
mjv04670  Leukocyte transendothelial migration
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04727  GABAergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04916  Melanogenesis
mjv04918  Thyroid hormone synthesis
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04925  Aldosterone synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04935  Growth hormone synthesis, secretion and action
mjv04960  Aldosterone-regulated sodium reabsorption
mjv04961  Endocrine and other factor-regulated calcium reabsorption
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05032  Morphine addiction
mjv05143  African trypanosomiasis
mjv05146  Amoebiasis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108395733 (PRKCG)
   04012 ErbB signaling pathway
    108395733 (PRKCG)
   04014 Ras signaling pathway
    108395733 (PRKCG)
   04015 Rap1 signaling pathway
    108395733 (PRKCG)
   04310 Wnt signaling pathway
    108395733 (PRKCG)
   04370 VEGF signaling pathway
    108395733 (PRKCG)
   04066 HIF-1 signaling pathway
    108395733 (PRKCG)
   04020 Calcium signaling pathway
    108395733 (PRKCG)
   04070 Phosphatidylinositol signaling system
    108395733 (PRKCG)
   04071 Sphingolipid signaling pathway
    108395733 (PRKCG)
   04150 mTOR signaling pathway
    108395733 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108395733 (PRKCG)
   04540 Gap junction
    108395733 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108395733 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    108395733 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    108395733 (PRKCG)
   04670 Leukocyte transendothelial migration
    108395733 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    108395733 (PRKCG)
   04929 GnRH secretion
    108395733 (PRKCG)
   04921 Oxytocin signaling pathway
    108395733 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    108395733 (PRKCG)
   04918 Thyroid hormone synthesis
    108395733 (PRKCG)
   04919 Thyroid hormone signaling pathway
    108395733 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    108395733 (PRKCG)
   04916 Melanogenesis
    108395733 (PRKCG)
   04925 Aldosterone synthesis and secretion
    108395733 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108395733 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    108395733 (PRKCG)
   04971 Gastric acid secretion
    108395733 (PRKCG)
   04972 Pancreatic secretion
    108395733 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108395733 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    108395733 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    108395733 (PRKCG)
   04727 GABAergic synapse
    108395733 (PRKCG)
   04725 Cholinergic synapse
    108395733 (PRKCG)
   04728 Dopaminergic synapse
    108395733 (PRKCG)
   04726 Serotonergic synapse
    108395733 (PRKCG)
   04720 Long-term potentiation
    108395733 (PRKCG)
   04730 Long-term depression
    108395733 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    108395733 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108395733 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108395733 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108395733 (PRKCG)
   05206 MicroRNAs in cancer
    108395733 (PRKCG)
   05205 Proteoglycans in cancer
    108395733 (PRKCG)
   05231 Choline metabolism in cancer
    108395733 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108395733 (PRKCG)
   05214 Glioma
    108395733 (PRKCG)
   05223 Non-small cell lung cancer
    108395733 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    108395733 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    108395733 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    108395733 (PRKCG)
   05032 Morphine addiction
    108395733 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108395733 (PRKCG)
   05161 Hepatitis B
    108395733 (PRKCG)
   05171 Coronavirus disease - COVID-19
    108395733 (PRKCG)
   05163 Human cytomegalovirus infection
    108395733 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108395733 (PRKCG)
   05143 African trypanosomiasis
    108395733 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108395733 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108395733 (PRKCG)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108395733 (PRKCG)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108395733 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 108395733
NCBI-ProteinID: XP_017513716
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTVDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFTLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWFKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRTGPSHSPSPSPSPSPTDSKRCFFGVSSGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKEHVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPAIRAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggcctgggccccggtggaggcgattcagaagggggaccccgacccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc
cgcttcttcaagcagcctaccttctgcagccactgcaccgacttcatctgggggattgga
aaacagggcctgcaatgtcaagtctgcagttttgtggttcatcgacgatgccacgagttt
gtgaccttcgagtgtccaggtgctgggaaaggtccccagacagacgacccccggaacaag
cacaagttccgcctgcacagctacagcagccccaccttctgcgaccactgcggctccctc
ctttacgggctggtgcaccagggcatgaagtgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgtggcgtggaccacaccgagcgccgcgggcgc
ttgcagctggaaatccgggcgcccaccgtggacgagattcacgttacggttggcgaggcc
cgtaacctcattccaatggaccccaatggtctgtctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgaccaaacagaagacccggacagtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaccctgaagcccggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacatcccgcaatgacttcatgggggccatgtcc
ttcggggtctcggagctgctcaaggcgcccgtggacggctggttcaagttactgaaccag
gaggagggtgaatattacaatgtgccagtggctgatgctgacaactgcagtctcctccaa
aagtttgaggcctgtaactaccccctggaactgtatgagcgggtgcggacgggcccctct
cactctcccagtccctctccgtcccccagccccaccgactccaagcgctgcttcttcggg
gtgagctctgggcgtctgcacatctccgacttcagcttcctcatggtcctgggcaaaggc
agctttgggaaggtcatgctggccgagcgcaggggctctgatgagctatacgccatcaag
atcctgaagaaagacgtgattgtccaggacgatgatgtggactgcaccctggtggagaag
cgtgtgctggcattggggggccgaggccccgggggccggcctcactttctcactcagcta
cactccaccttccagaccccggaccgtctgtattttgtgatggagtacgtcaccgggggc
gacttgatgtaccacattcagcagctgggcaagtttaaggagccccatgcagcgttctac
gcagcggaaatagccatcggcctcttcttccttcacaatcaaggcattatctaccgggac
ctgaaactggacaacgtgatgctggacgctgaagggcacatcaaaatcaccgacttcggc
atgtgtaaagagcacgtcttccccgggaccacgacccgcaccttctgtgggacgccagac
tacatagctcccgagatcattgcctaccagccctatgggaagtctgttgattggtggtcc
tttggggttctgctgtatgagatgctggcaggacagcccccctttgatggagaggacgag
gaggagctgttccaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctaaccaagcaccctgccaagcgccttggctca
gggccagatggggaacccgccatccgtgctcacggctttttccgttggatggactgggag
cggctggaacgactggagatcgcgcctccgttcagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcacgcgggcggcgccagcgctgacacccccggaccgcctg
gttctggccagcatcgaccaggcggacttccagggcttcacctacgtgaaccccgatttc
gtgcacccggacgcccgcagccccattagccccacgcccgtgcccgtcatgtaa

DBGET integrated database retrieval system