KEGG   Manis javanica (Malayan pangolin): 108385741
Entry
108385741         CDS       T06054                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05163  Human cytomegalovirus infection
mjv05200  Pathways in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385741 (PDGFRA)
   04014 Ras signaling pathway
    108385741 (PDGFRA)
   04015 Rap1 signaling pathway
    108385741 (PDGFRA)
   04630 JAK-STAT signaling pathway
    108385741 (PDGFRA)
   04020 Calcium signaling pathway
    108385741 (PDGFRA)
   04072 Phospholipase D signaling pathway
    108385741 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    108385741 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108385741 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108385741 (PDGFRA)
   04540 Gap junction
    108385741 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108385741 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385741 (PDGFRA)
   05206 MicroRNAs in cancer
    108385741 (PDGFRA)
   05230 Central carbon metabolism in cancer
    108385741 (PDGFRA)
   05231 Choline metabolism in cancer
    108385741 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    108385741 (PDGFRA)
   05218 Melanoma
    108385741 (PDGFRA)
   05215 Prostate cancer
    108385741 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108385741 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108385741 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108385741 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mjv04090]
    108385741 (PDGFRA)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108385741 (PDGFRA)
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108385741 (PDGFRA)
CD molecules [BR:mjv04090]
 Proteins
  108385741 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 108385741
NCBI-ProteinID: XP_017498773
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHRALLVSGCLLTGLSLILCQLSLPSILPNENEKVVRLNSSFSLSCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLAVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVTASYDSRQGFNG
TFGVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGDTIVVTCAVFNN
EVVDLQWTYPGEVKGKGRTTLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSQLEAVDLHEVKHFVVDVEAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWMILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEIKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKEWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatcgggccctcctggtctcaggctgtctgctcacagggctgagccta
atcctctgccagctttcattgccctctatccttccaaatgaaaatgaaaaggttgtgcgg
ctgaattcatccttttctctgagctgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaatgaggagaacaacagtggcctt
tttgtgacagtgctggcagtggtcaatgcctccgcagcccacacgggattgtacacttgc
tattacaaccacactcagacagaggaaaatgagattgaaggcagacgaatctacatctat
gtaccagacccagatgtagcctttgtacctctaggaatgacagattatttagtcattgtg
gaggatgatgattctgccatcataccttgtcgcacaactgatcctgagaccccggtgacc
ttactcagcagtgacggggtagtgacggcctcctatgacagcagacagggctttaacgga
accttcggtgttgggccctatatctgtgaggctactgtcagagggaagaagttccagacc
atcccatttaatgtgtatgctttaaaagcaacatcagaacttgatctagaaatggaagct
cttaaaactgtatataagtcgggggacacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggccggacaacg
ctcgaggaaatcaaggtcccatccatcaaactggtgtacactctgacagtccctgaggcc
accgtgaaagacagtggagattacgaatgtgctgcacgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtccatgagaaagggttcattgaaatcaaacccaac
tttagccagttggaagctgtggacctgcatgaagtcaaacattttgtggtggacgtggag
gcctatccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
actgagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagttcaaaacgaagat
gacgtgaagagctatactttcgaactgttaactcaggttccctcatctattctggactta
gtggatgaccaccatggttctaccgggggacagaccgtgagatgcacagctgaagggaca
cctcttcctgatattgagtggatgatttgcaaggatatcaagaaatgtaataatgaaacc
tcgtggatgattttggccaacaacatctcaaacatcatcacagaggtccacccgcgagac
aggagtacggtggagggcagagtgactttcgccaaagtggaggagaccattgcggttcga
tgtctggcaaagaatctccttggggctgagaatcgagagctgaagctggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgctgttggtgattgtcatcatc
tcacttattgttctggttgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcaatcagccctgatggacacgaatatatttatgtggatccgatgcagctg
ccttatgactcaagatgggagtttccgagagatggactagtgcttggtcgtatcctggga
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccagcct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccgcatttaaatattgtaaacttg
ctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgaaccctgctgatgagagcacacggagttac
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtcccaatgctggaaaggaaagaggtttctaaatattcggacatccagagatca
ctatatgatcgcccagcctcgtataagaagaaatccatgttagactcagagatcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttaagctttacttac
caagttgcccgaggcatggagttcttggcttcaaaaaattgtgtccaccgggacctggct
gctcgcaatgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcacgactcgaactacgtgtcaaaaggcagtacttttctcccagtgaag
tggatggctccggagagcatctttgacaacctgtacactacactgagtgacgtctggtct
tacggcattctcctctgggagatcttttccctcggtggcaccccctaccccggcatgatg
gtggattctaccttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatcttctgcctggacaatacaaaaag
agctatgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcacgcatg
cgcgtggactcggacaacgcctacattggcgtcacctacaagaacgaggaagacaagctg
aaggagtgggagggcagcctggacgagcagaggctgagcgcggacagcggctacatcatc
cctctgcccgacatagaccctgtaccggaggaagaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctacattcatc
aagagagaggatgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system