KEGG   Manis javanica (Malayan pangolin): 108385913
Entry
108385913         CDS       T06054                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04012  ErbB signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04115  p53 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04218  Cellular senescence
mjv04630  JAK-STAT signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04934  Cushing syndrome
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05216  Thyroid cancer
mjv05217  Basal cell carcinoma
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108385913 (CDKN1A)
   04630 JAK-STAT signaling pathway
    108385913 (CDKN1A)
   04066 HIF-1 signaling pathway
    108385913 (CDKN1A)
   04068 FoxO signaling pathway
    108385913 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    108385913 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108385913 (CDKN1A)
   04115 p53 signaling pathway
    108385913 (CDKN1A)
   04218 Cellular senescence
    108385913 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108385913 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    108385913 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108385913 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    108385913 (CDKN1A)
   05206 MicroRNAs in cancer
    108385913 (CDKN1A)
   05205 Proteoglycans in cancer
    108385913 (CDKN1A)
   05203 Viral carcinogenesis
    108385913 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108385913 (CDKN1A)
   05212 Pancreatic cancer
    108385913 (CDKN1A)
   05225 Hepatocellular carcinoma
    108385913 (CDKN1A)
   05226 Gastric cancer
    108385913 (CDKN1A)
   05214 Glioma
    108385913 (CDKN1A)
   05216 Thyroid cancer
    108385913 (CDKN1A)
   05220 Chronic myeloid leukemia
    108385913 (CDKN1A)
   05217 Basal cell carcinoma
    108385913 (CDKN1A)
   05218 Melanoma
    108385913 (CDKN1A)
   05211 Renal cell carcinoma
    108385913 (CDKN1A)
   05219 Bladder cancer
    108385913 (CDKN1A)
   05215 Prostate cancer
    108385913 (CDKN1A)
   05213 Endometrial cancer
    108385913 (CDKN1A)
   05224 Breast cancer
    108385913 (CDKN1A)
   05222 Small cell lung cancer
    108385913 (CDKN1A)
   05223 Non-small cell lung cancer
    108385913 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108385913 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108385913 (CDKN1A)
   05161 Hepatitis B
    108385913 (CDKN1A)
   05160 Hepatitis C
    108385913 (CDKN1A)
   05163 Human cytomegalovirus infection
    108385913 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108385913 (CDKN1A)
   05169 Epstein-Barr virus infection
    108385913 (CDKN1A)
   05165 Human papillomavirus infection
    108385913 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108385913 (CDKN1A)
   01522 Endocrine resistance
    108385913 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108385913
NCBI-ProteinID: XP_017499022
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDAHQVLRSSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGMPKLYLPEGLWGCRDDLGGGKRPSPSPALLQGTAQEDHVDLSLSCTFL
PHSPERPEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatccagggacgcccatcaggtcctgcgcagcagcaaggcctgccgccgc
ctcttcggcccagtggacagtgagcagcttcgccgcgactgtgatgcactaatggcaggc
tgcgtgcaggaggcccgggagagatggaatttcgactttgtcaccgagacacctctggag
ggcgacttcgcctgggagcgtgtgtggggcctcggcatgcccaagctctacctgcctgag
gggctatgggggtgccgggacgacctgggagggggcaagcggcctagcccctcacctgcc
ctgttgcaggggacagctcaggaggaccacgtggacctgtcactgtcctgtaccttcctg
cctcactcacctgagcggcctgaggggtccccaggcgggcctggcacttctcagggccga
aaaagacggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctct
aagaggaagccctaa

DBGET integrated database retrieval system