KEGG   Manis javanica (Malayan pangolin): 108385943
Entry
108385943         CDS       T06054                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05135  Yersinia infection
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108385943 (NFATC1)
   04310 Wnt signaling pathway
    108385943 (NFATC1)
   04024 cAMP signaling pathway
    108385943 (NFATC1)
   04022 cGMP-PKG signaling pathway
    108385943 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108385943 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108385943 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    108385943 (NFATC1)
   04660 T cell receptor signaling pathway
    108385943 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    108385943 (NFATC1)
   04659 Th17 cell differentiation
    108385943 (NFATC1)
   04662 B cell receptor signaling pathway
    108385943 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108385943 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108385943 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108385943 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108385943 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108385943 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108385943 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108385943 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    108385943 (NFATC1)
   05161 Hepatitis B
    108385943 (NFATC1)
   05163 Human cytomegalovirus infection
    108385943 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108385943 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108385943 (NFATC1)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    108385943 (NFATC1)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DENN
Other DBs
NCBI-GeneID: 108385943
NCBI-ProteinID: XP_017499049
LinkDB
Position
Unknown
AA seq 856 aa
MAAASHPPGYGGTVDGGYFLPSGHSRPSGAPALESPRIEITSYLGLQHSPGPFLHDVDVE
DALPSSRRPPSTATLTLPPLEAYRDPSCLSPASSLSSRSCNSEASSYESGFSYPYASPQT
SPWQSPCVSPRTTDPEEGFPRGLGACSLLGSPRHSPSTSPRTSITEESWLGARASRPSSP
CNKRKHGLNGRQPPGSPHPSPTPSPHGSPRVSVTDDTWLGNTTQYTSSAIVAAINALSTD
SSLDLGDGVPIKARKTALDHSPSVALKVEPTSEDLGATPPSPDFLPEEFPSFQQVRKGAF
CDQYLSVPQHPYQWARPRSPTSYASPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYET
EGSRGAVKASAGGHPSVQLHGYLEAEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVST
TSHEAILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVF
RVHIPQPGGRVLSLQAASNPIECSQRSAQELPLVEKQSAASCPVLGGKKMVLSGHNFLQD
SKVIFVEKAPDGHHIWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVQVSFYVCNGKRK
RSQYQHFTYLPANVPIIKTEPTDEFEPALTCGPASQGLSPLVKPRYSQQLAVPPAPGSCL
VAGFPPCPQRSTVMSPLPCASPELHDLSSAAYSKDLASPGCGHLGLQRPTGGILTAQEAP
RPVGVHPGSPQQPPPALLQPQVSPQPSSSVGRRPALSPDSPPPTPPGAQELTCLQSCSPA
RPSVLGRPQQQVPEVSRSESAAARPLPLPEVREDSTHSLAPMPVMVKREPQDLDQLYLDD
VNEIIRNDLSSTSIHS
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggcggcagccagtcaccccccggggtacggaggcactgtggatggcggctacttcctc
ccatctggccacagcaggcccagcggagcgcctgccctggagagcccccgcattgagatc
acctcgtacctggggctgcagcacagccctggccccttcctgcatgacgtggatgtggag
gacgctctgcccagctccaggcggcccccgtccactgccaccttgacgctgccccccctg
gaggcctaccgcgacccctcgtgcctgagcccggccagcagcctgtcctcacgcagctgc
aactccgaagcctcgtcctacgagtccggcttctcctacccgtacgcgtccccgcagacc
tccccatggcagtccccctgtgtgtcccccaggaccacggacccagaggagggctttccc
cggggcctgggtgcctgcagcctgcttgggtccccgaggcactcaccctccacgtcaccc
cgaaccagcatcacagaggagagctggctgggggcccgtgcctcccggccctcgtccccc
tgcaacaagaggaagcatggcctcaatggccggcagccgcctggctccccccacccctcg
cccacaccgtcccctcacggctcaccacgggtcagtgtcactgacgacacctggctgggc
aacaccacgcagtataccagctcagccatcgtggccgccatcaatgcgctgagcacagac
agcagcctggacctgggcgacggcgtccctatcaaggcccgcaagaccgccctggaccac
tcgccctcggtggccctcaaggtggagccgaccagcgaggacctgggggctacgccgccc
tcgcctgacttcctgcctgaggagttcccgtcctttcagcaggtccgcaagggtgccttc
tgcgaccagtacctgtcggtgccccagcacccataccagtgggccaggcccaggtccccg
acatcctatgccagcccctcgctgccggccctcgactggcagctgccgtcgcactcggga
ccctacgagctgaggattgaagtgcagcccaagtcccaccacagagcccactacgagaca
gaggggagccgcggggccgtgaaggcgtcggccggaggacaccccagcgtgcagctgcat
ggctacttggaggccgagccgctcacgctgcagctgttcatcgggacagcggacgaccgc
ctgctgagacctcacgccttctaccaggtccaccggatcacggggaagactgtgtccacc
accagtcacgaagctatcctgtccaacaccaaagtcctggaaattccactcctgccggaa
aataacatgcgagcaatcatcgactgtgccgggatcctgaagctgcggaactcagacatc
gagctgcgcaagggggagacggacatcgggaggaagaacacgcgcgtgcggctggtgttc
agagtgcacatcccgcagcccggcggccgcgtgctgtcgctccaggcggcctcgaacccc
atcgagtgctcccagcggtcagcccaggagctgccccttgtggagaagcagagcgcagcc
agctgccccgtcctcggcgggaagaagatggtcctgtctggccacaacttcctgcaggac
tccaaggtcatttttgtggagaaagcgccagacggtcaccacatctgggagatggaggca
aaaaccgaccgtgacctgtgcaagccaaactcgctggtggtggagatcccgccttttcgc
aaccagagaataaccagccccgtccaagtcagtttctacgtctgcaacgggaagaggaag
agaagccagtaccagcacttcacctaccttcctgccaacgttccaatcataaagacggag
cccacagatgagtttgaacctgccctgacctgtggaccggccagccagggcctcagccca
ctcgtgaagccacgctacagccagcagctggccgtgccacctgccccgggctcctgcctg
gtggccggcttcccaccctgtccacagagaagcaccgtgatgtccccactgccctgtgcc
agcccggagctccacgacctctcctctgctgcctacagcaaggacctggccagcccaggc
tgtggccacctcggacttcagcggccaaccggagggatcctcacagctcaggaggcgccg
agacctgtgggcgtgcaccctggctccccccagcagccgccccctgcccttctgcagcca
caggtgagtccccagccgagcagcagtgtgggccgccggccggcgctctctcccgacagc
ccccctccaacaccacctggtgcccaggagctgacctgcttgcagtcttgcagcccggcc
cgtccgtccgtgctgggccgcccgcagcagcaagtgccggaggtctcaaggagcgagtct
gcagctgcccggccactgccgctgcccgaggtgcgtgaggacagtactcatagcctggcc
cccatgcccgtaatggtcaagcgagagcctcaagacttggaccagctgtacctggacgac
gtaaatgaaataataagaaacgacctctccagcaccagcatccattcatag

KEGG   Manis javanica (Malayan pangolin): 108391749
Entry
108391749         CDS       T06054                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04022  cGMP-PKG signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04921  Oxytocin signaling pathway
mjv05135  Yersinia infection
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108391749
   04370 VEGF signaling pathway
    108391749
   04022 cGMP-PKG signaling pathway
    108391749
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108391749
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108391749
   04650 Natural killer cell mediated cytotoxicity
    108391749
   04660 T cell receptor signaling pathway
    108391749
   04658 Th1 and Th2 cell differentiation
    108391749
   04659 Th17 cell differentiation
    108391749
   04662 B cell receptor signaling pathway
    108391749
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108391749
  09158 Development and regeneration
   04360 Axon guidance
    108391749
   04380 Osteoclast differentiation
    108391749
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108391749
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108391749
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108391749
   05170 Human immunodeficiency virus 1 infection
    108391749
   05161 Hepatitis B
    108391749
   05163 Human cytomegalovirus infection
    108391749
   05167 Kaposi sarcoma-associated herpesvirus infection
    108391749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108391749
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    108391749
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 108391749
NCBI-ProteinID: XP_017506987
LinkDB
Position
Unknown
AA seq 477 aa
MENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNN
MRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSSRIVSLQTASNPIE
CSQRSAHELPMVERQDIDSCLVCGGQQMILTGQNFTAESKVVFTEKTTDGQQIWEMEATV
DKDKSQPNMLFVEIPEYRNKHIRVAVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDE
YDPTLICSPAHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRSGLPSPDARYQQQNPA
AVLYQRSKSLSPSLLGYQQPALMATPLSLADAHRSVLVHAGSQGQSAALLHPSPANQQAS
PVIHYSPSNQPLRCGGHQEFQHIMYCENFAPSTTRSGPPPVSQGQRLSPGSYPTVIQQQN
ATSPRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPTRNQT
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggaaaacaagcccctggggcttcagatcttcattgggacggctgatgagcggatcctt
aaaccccacgccttctaccaggtgcaccggatcacgggaaaaactgtcaccaccaccagc
tatgagaagattgtgggcaacaccaaagtcctggagatccctctggagccaaaaaacaac
atgagggcgaccatcgactgtgcgggaatcctgaagcttagaaatgccgacattgagctg
cggaaaggcgagacagacatcgggagaaagaacacgcgtgtgaggctcgttttccgagtg
cacatcccggagtccagcagcaggattgtgtccttgcagacggcgtccaaccccattgag
tgctcccagcgatccgcccacgagctgcccatggtggaaagacaggacatcgacagctgc
ctggtctgtgggggccagcagatgattctcaccggacagaacttcacagccgagtccaaa
gtcgtgtttactgagaagaccacagatgggcagcaaatttgggagatggaagccacagtg
gacaaagacaaaagccagcctaacatgctttttgttgagatccctgagtatcggaataag
cacatccgtgtggcagtgaaggtgaacttctacgtgatcaatgggaaaagaaaacgaagt
cagcctcagcactttacctatcacccagtcccagccatcaagacggagcccactgatgaa
tatgaccccaccttgatctgcagccctgcccatgggggcctggggagccagccttactac
ccacagcacccgatggtggctgagtccccctcctgcctcgtggccaccatggctccctgc
cagcaattccgctcggggctcccgtcccctgatgcccgctaccagcagcagaacccagca
gctgttctctatcagcggagcaagagcctgagccccagtctgttgggttaccagcagcca
gccctcatggccacccccctgtcccttgcggacgcccaccgctccgtgctggtacacgct
ggctcccagggccagagcgcagccctgctccacccctctccggccaaccagcaggcctca
ccagtgatccactactcacccagcaaccagccgctgcgctgcggaggccaccaggaattc
cagcacatcatgtactgcgagaatttcgcccccagcaccaccaggtccggccctcccccc
gtcagtcaaggtcagaggctgagcccggggtcctaccccacagtcattcagcagcagaat
gccacaagcccaagagctgccaaaaacggacccccagtcagtgaccaaaaggaagtatta
cctgcaggagtgacaattaaacaggagcagaacttggaccagacctacttggatgatgtt
aatgaaataatcaggaaggagttttcaggacctcccaccagaaatcagacgtag

KEGG   Manis javanica (Malayan pangolin): 108402601
Entry
108402601         CDS       T06054                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04625  C-type lectin receptor signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04921  Oxytocin signaling pathway
mjv05135  Yersinia infection
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108402601 (NFATC3)
   04310 Wnt signaling pathway
    108402601 (NFATC3)
   04022 cGMP-PKG signaling pathway
    108402601 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108402601 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108402601 (NFATC3)
   04660 T cell receptor signaling pathway
    108402601 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    108402601 (NFATC3)
   04659 Th17 cell differentiation
    108402601 (NFATC3)
   04662 B cell receptor signaling pathway
    108402601 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108402601 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    108402601 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108402601 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108402601 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108402601 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    108402601 (NFATC3)
   05161 Hepatitis B
    108402601 (NFATC3)
   05163 Human cytomegalovirus infection
    108402601 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108402601 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108402601 (NFATC3)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    108402601 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 108402601
NCBI-ProteinID: XP_017524731
LinkDB
Position
Unknown
AA seq 1081 aa
MTTANCGAHDELDFKLVFGEDGAPAPPSSGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSSSFQFQGHKNYEGSCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAHEDDVHINDPEREFLERPSRDHLYLPLESSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSADVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASLXTWLNASLQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATVLP
GKLELCSDDQGSLSPSRESSIDDGLGSQYTLKKDSSGDQYLSVPSPFTWSKPKPGHTPIF
RTSSLPPLDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYS
EKPINLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMS
ASIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECS
QRSAQELPHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIR
EKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDL
SSVPSLSVPHPAQTQRPSSDTGHPCDSVLSAQRSLVCPIQQTYASMVTSSHLPQLQCRDE
SAGKEQHMMPSSVVHQPFQVTPTPTAGSSYQPMQTNLYNGPTCLPINAASSQEFDTVLFQ
QDAALPSLINISCQPPSIPFHSSNSGSTGHLLAHIPHSVQTLPHLQSMGYHCSNTGQRSL
SSPVADPVTGQPSSQLQPITYGPSHSGSATAVSPAASHPLASSPLSGPPSPQLQPMPYQS
PSSGTASSPSLATRMHSGQHSTQAQSTGQGGLSATSSLICHSLCDPTSFPPEETTVNIKP
EPEEQEPNFSTIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQPPLPGPDSLDLGRSGR
P
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggggag
gacggggctccggcgccgccgtcctcgggctcacggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaattcaccactt
tgcttaccccatcatggactaccgtctcactcctctgttttgtcatcatcgtttcagttc
caaggtcacaaaaactacgaaggaagttgtgaaattcctgaatctaaatacagtccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatgctcatgaagatgatgtacacataaatgacccagaaagggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgagtcatcctaccgggagtct
tcccttagccctagtcctgccagcagcatctcttctaggagctggttctcagatgcatct
tcttgtgaatctctttcacatatttatgatgatgtggattcagagttgaatgaagctgct
gcccgatttactctcggatcccctctgacttctcctggtggctctccaggaggctgccct
ggagaggagtcctggcatcaacagtatggacttggacactccttatcacccaggcaatct
ccttgccactctcctagatctagtgtcactgatgagaattggttgagccccaggccagcc
tcaggaccctcatcaaggcctacttccccctgtgggaaacggcggcactctagtgctgat
gtttgctatgctgggtccctttcaccccatcactcacctgttccttctcccggtcactcc
cccaggggaagtgtaacagaagatacctggctcaatgcttctctccanacctggctcaat
gcttctctccagggtggatcaggccttggtcctgcactttttccatttcagtactgtgta
gagactgatatccctctgaaaacaaggaagacttctgaagatcaagctactgtactacca
ggaaaattagaactctgttcagatgaccaagggagtttatcaccatcccgagagtcttca
atagatgatggccttggatctcagtatacattaaagaaagattcatctggtgaccaatat
ctttcagttccttcaccttttacctggagcaaaccaaaacctggccacacccctatattt
cgcacatcttcattacctccactagactggcctttaccaactcattttggacagtgtgaa
ctgaaaatagaagtgcaacctaaaactcatcatcgagcccattatgaaactgaaggtagc
cgaggagcagtaaaagcatctactgggggacatcctgttgtgaagctcctgggctatagt
gaaaagccgataaatctacagatgtttattggaacggcagatgatagatatttacgacct
catgcattttatcaggtgcatcgaatcactgggaaaacagttgctactgcaagccaagag
ataataattgctagtacaaaagttttggaaattccacttcttcctgaaaacaatatgtca
gccagtattgactgtgcaggtattttgaaactccgcaattcagatatagaacttcgaaaa
ggagaaactgatattggcagaaagaatactagagtacgacttgtatttcgcgtacacatc
ccacagcccaatggaaaagttctttctctgcagacagcttctatacctgtagagtgctcc
cagcggtctgctcaagaacttcctcatattgagaagtatagtatcaacagttgttctgta
aatggaggtcatgaaatgattgtgactggatctaattttcttccagaatccaaaatcatt
tttcttgaaaaaggacaagatggacgacctcagtgggaggtagaagggaaaataatcagg
gaaaaatgtcaaggggctcacattgttcttgaagttcctccatatcataacccagcagtt
acagctgcagtgcaggtgcacttttatctttgcaatggcaagaggaaaaaaagccagtct
caacgttttacttacacaccagttctgatgaagcaagaacacagagaggagattgacttg
tcttcagttccatcattgtctgtgcctcatcctgcccaaacccagaggccttcctcagat
acaggacacccatgtgacagtgtactgtcagcacagagaagcttggtttgtcccatccag
caaacatacgcatccatggtaacctcatcccatctgccacagttgcagtgtagggatgag
agtgctggtaaagaacagcatatgatgccttcttcagttgttcaccagccttttcaagtc
acaccaacacctactgcggggtcttcctatcagcctatgcaaactaatctgtacaatgga
ccaacttgtcttcctattaatgctgcctctagtcaagaatttgatacagttttgtttcag
caggatgcagcgcttcctagcttaataaatattagctgtcaaccaccatccatacctttt
cattcttcaaattcaggctcaacaggacatctcttagcccacatacctcattcagtgcag
actctgcctcatctgcagtcaatggggtaccactgttcaaacacaggacaaagatctctt
tcttctccagtggctgacccagtcacaggtcagccttcttctcagttacaaccgattaca
tatggtccttcacattcagggtctgctacagcagtttccccagcagcctctcatcccttg
gccagttcaccactttctgggccaccgtctcctcagctccagccaatgccttaccaatct
cctagctcaggaactgcctcatcaccatctctagccaccagaatgcattctggacagcac
tctacccaagcacaaagtacaggccagggaggtctttcagcaacttcatcattaatatgt
cacagtctgtgtgatccaacttcatttccacctgaagagacaactgtgaacattaaacct
gaacctgaagagcaggaacctaacttttcaacaattggtctacaggacatcactttagat
gatgtgaacgagataattgggagagacatgtcccagatttccgtttcccaaggagcaggg
gtgagcaggcagcctcccctcccaggtcctgattccctggatttaggaagatccggcagg
ccctga

KEGG   Manis javanica (Malayan pangolin): 108410202
Entry
108410202         CDS       T06054                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04022  cGMP-PKG signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04625  C-type lectin receptor signaling pathway
mjv04921  Oxytocin signaling pathway
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108410202 (NFATC4)
   04022 cGMP-PKG signaling pathway
    108410202 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108410202 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108410202 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108410202 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    108410202 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108410202 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    108410202 (NFATC4)
   05161 Hepatitis B
    108410202 (NFATC4)
   05163 Human cytomegalovirus infection
    108410202 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108410202 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108410202 (NFATC4)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    108410202 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 108410202
NCBI-ProteinID: XP_017536645
LinkDB
Position
Unknown
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEELDSEDAPPCCRLALGEPSPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGAPGGGSGGAGGSRVLECPSIRITS
ISPTPDPPAALEDSPDVWGDGSPRDYPPPEGFGGYREAGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSSGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVAQPRSEEPTPCNGKLSSGAEE
AGAPPGGPRKEVAGMDYLAVPSPLTWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PIQAYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDTSLRGFPSASGPPFGTDMDFSPPRP
PYPSYPHDDPGYETPYLTEGFSYGTSPLYPQTGPPPCYRSGLRLFPETGCTTGCSRPPPV
SFLPRPFPSDPYGGQGSPFPLGLPFPPPAPFRPSLPSSPPLEGPFPSQSGVRAPSAEGFN
EVGPSYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcaagctgcgaggatgaagagctggaatttaagctggtgttcggggaggaa
aaggaggcccctccgctgggcgcggggggatcgggggaagaactggactcagaggacgcc
ccaccatgctgccgtctggccctgggggagccctctccctatggcgctgcccctattggc
attccccggcctccaccccctcggcctggcatgcactcaccaccaccccgcccagccccc
tcacctggcacttgggagagccagccagcccggtcagtgaggctgggggccccaggaggg
ggctccgggggggctgggggaagccgtgttcttgagtgtcccagcatccgcatcacttcc
atctctcccacgccggacccgcctgccgcgctggaggacagcccggacgtctggggggat
ggctcccccagggattaccccccaccagaaggctttgggggctaccgagaggcagggggc
cagggagggggccccttcttcagcccgagccctggcagcagcagcctgtcctcgtggagc
ttcttttcagacgcttccgacgaggcagctctgtatgccgcctgcgatgaggtggagtcc
gagctaaatgaggctgcctcccgcttcggcctgggctctccactgccgtcaccccgggcc
tctcctaggccatggaccccagatgatccctggagcctgtatggtcccagctctggaggc
cgggggccagaggatagctggctactcctcagtgctcctgggcccacccctgcctcccca
cggcctgcctctccatgtggcaagcggcgttattccagttcagggaccccatcttcggcc
tccccagctctgtcccgccgtggcagtctcggggaggaggggcctgagccccctccacca
cccccattgcctcttgcccgggatcctggctcccctggtccctttgactacgtgggagcc
ccacctgcggagagcataccccagaagacccggcggacttccagtgagcaggcagtggcc
cagcctcggtctgaggaacctaccccctgcaatgggaaactgtcttctggagcagaggag
gccggggctccccctgggggtcctcggaaggaagtggctggcatggactacctggctgtg
ccctcccctcttacttggtccaaggcccggattgggggacacagccccatcttcaggacc
tctgccctacccccactggactggcctctgcccagccagtatgagcagctggagctgagg
attgaggtgcagcctagagcccaccaccgggcccactatgagacagagggtagccgcgga
gctgtcaaagctgctcctggtggtcaccctgtagtcaagctcctaggttacagtgagaag
cccctgaccctacagatgttcattggcactgcagatgaaaggaacctgaggccccatgcc
ttctatcaggtgcaccgtatcaccggcaagatggtggccacggccagctatgaggctgta
gtcagtggcaccaaggtgttggagatgactctgcttcctgagaacaacatggcagccaac
attgactgtgctggaatcctgaagcttcggaattcagacattgaactgaggaagggggag
acagacattgggcgcaagaacacacgtgtgcggctggtattccgggtccatgtgccccag
ggcagcgggaaggtcgtctccgtgcagacagcatctgtgcccatcgagtgttctcagcgc
tcagcccaggagctgcctcaggtggaggcctacagccccagtgcttgctctgtgagagga
ggagaggaacttgtgctgactggctccaacttcctgccagactccaaggtggtattcatc
gagaggggccctgatggaaagctgcagtgggaggaggaggccacagtgaaccggttgcag
agcaatgaggtcacactaaccctgactgtccctgagtacagcaacaagcgggtgtctagg
cccatccaggcctacttttatgtttccaacggacggaggaagcgcagccctacccagagt
ttcaagttcctgcctgtgatctttaaggaggagcctctgccagacacatctctccggggc
ttcccttcagcatcgggtcccccctttggcactgacatggacttctcaccaccccggccc
ccttacccctcttatccccatgatgaccctggttatgaaactccttacctgacagaaggc
ttcagctatggcacatcccctctgtatccccagacagggcccccaccatgctacagatct
ggcctgcggttgttccctgagactgggtgtaccacaggttgttcccgcccacctccagtc
tccttccttccccggcccttccccagtgatccctatggaggacagggctccccttttccc
ctggggctgccattccctcctccagcccccttccggccttccctgccttcatccccacct
cttgaaggtccctttccttcccagagtggtgtccgtgccccatctgctgagggattcaat
gaggtagggccaagctatggccctggggagggggctccggagcaggagaaatccaggggt
ggctacagcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctcct
gcctga

DBGET integrated database retrieval system