KEGG   Manis javanica (Malayan pangolin): 108386668
Entry
108386668         CDS       T06054                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: calcineurin subunit B type 2-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108386668
   04310 Wnt signaling pathway
    108386668
   04370 VEGF signaling pathway
    108386668
   04020 Calcium signaling pathway
    108386668
   04022 cGMP-PKG signaling pathway
    108386668
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108386668
   04218 Cellular senescence
    108386668
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108386668
   04650 Natural killer cell mediated cytotoxicity
    108386668
   04660 T cell receptor signaling pathway
    108386668
   04658 Th1 and Th2 cell differentiation
    108386668
   04659 Th17 cell differentiation
    108386668
   04662 B cell receptor signaling pathway
    108386668
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108386668
   04921 Oxytocin signaling pathway
    108386668
   04924 Renin secretion
    108386668
  09156 Nervous system
   04724 Glutamatergic synapse
    108386668
   04720 Long-term potentiation
    108386668
  09158 Development and regeneration
   04360 Axon guidance
    108386668
   04380 Osteoclast differentiation
    108386668
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108386668
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108386668
   05014 Amyotrophic lateral sclerosis
    108386668
   05020 Prion disease
    108386668
   05022 Pathways of neurodegeneration - multiple diseases
    108386668
  09165 Substance dependence
   05031 Amphetamine addiction
    108386668
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108386668
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108386668
   05170 Human immunodeficiency virus 1 infection
    108386668
   05163 Human cytomegalovirus infection
    108386668
   05167 Kaposi sarcoma-associated herpesvirus infection
    108386668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108386668
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     108386668
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 108386668
NCBI-ProteinID: XP_017500147
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEMCSSFDQDEIKRLSKRFKKLAFDGSGALSVKESVRLPELWQSPLVQRGFS
IFGTDSHGEVDFKEFILGTSQFSVKGDEEQKLRSAFSVYDMDKDGYISNGKLFPVLKMMV
GDNLQDWQSQQIADRSSITLDTDGDGKISFEEFSAVVGGLEIHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atggggaatgaggccagttacccggaggagatgtgctccagctttgaccaagatgagatc
aaaaggctgagcaagaggtttaagaagctggccttcgacggctcgggcgcgctgagcgtg
aaggagtctgtgcgcctgcctgagctgtggcagagcccgctggtgcagcgagggttcagc
atcttcggcacggacagccacggcgaggtggacttcaaggagttcatcctggggacctcc
cagttcagcgtcaagggggatgaggagcagaagctgaggtctgcttttagcgtctacgac
atggataaggacggctacatctccaacggcaagctcttcccggtgctgaaaatgatggtt
ggggacaatctgcaggactggcagtcacagcagatcgcagacagatccagcatcaccctg
gacaccgacggcgacgggaaaatctccttcgaggaattcagtgccgtggtgggaggcctg
gagatccacaagaagctggtggtaatcgtttga

KEGG   Manis javanica (Malayan pangolin): 108391436
Entry
108391436         CDS       T06054                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04728  Dopaminergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108391436 (PPP3CA)
   04310 Wnt signaling pathway
    108391436 (PPP3CA)
   04370 VEGF signaling pathway
    108391436 (PPP3CA)
   04020 Calcium signaling pathway
    108391436 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    108391436 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108391436 (PPP3CA)
   04218 Cellular senescence
    108391436 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108391436 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    108391436 (PPP3CA)
   04660 T cell receptor signaling pathway
    108391436 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    108391436 (PPP3CA)
   04659 Th17 cell differentiation
    108391436 (PPP3CA)
   04662 B cell receptor signaling pathway
    108391436 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108391436 (PPP3CA)
   04921 Oxytocin signaling pathway
    108391436 (PPP3CA)
   04924 Renin secretion
    108391436 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    108391436 (PPP3CA)
   04728 Dopaminergic synapse
    108391436 (PPP3CA)
   04720 Long-term potentiation
    108391436 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    108391436 (PPP3CA)
   04380 Osteoclast differentiation
    108391436 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108391436 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108391436 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    108391436 (PPP3CA)
   05020 Prion disease
    108391436 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    108391436 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    108391436 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108391436 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108391436 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    108391436 (PPP3CA)
   05163 Human cytomegalovirus infection
    108391436 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108391436 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108391436 (PPP3CA)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108391436 (PPP3CA)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     108391436 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 108391436
NCBI-ProteinID: XP_017506521
LinkDB
Position
Unknown
AA seq 491 aa
VPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLD
IDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILY
PKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHG
GLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFY
SYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAA
VLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSE
EDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGG
KQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGT
DSNGSNSSNIQ
NT seq 1478 nt   +upstreamnt  +downstreamnt
ctgtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggga
agcctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagtg
ttgcattgagaataataacagagggggcttcaattctccgacaggaaaaaaatttgctgg
atatcgatgcaccagtcacagtttgtggtgacatccatggacaattctttgacttgatga
agctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatg
ttgacagaggatacttcagtattgaatgtgtgctgtatttgtgggccttgaaaattcttt
accccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatt
ttacgtttaaacaagaatgtaaaataaagtattcagaacgtgtttacgatgcctgtatgg
atgcctttgactgcttgcccctggctgccctgatgaaccagcagttcctgtgtgtacacg
gtggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaag
aaccacctgcttatggacctatgtgtgatatcctgtggtcagaccccctggaggattttg
gaaacgagaagactcaggaacatttcactcacaacaccgtcagggggtgttcgtacttct
acagttacccagctgtctgtgagttcctgcagcacaataacttgttatctatactccgag
cacatgaagcccaggatgcagggtatcgcatgtataggaaaagccaaacaacaggcttcc
cttctctaattacaattttttcagcaccaaattacttagatgtgtacaataacaaagctg
cagtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatc
catactggcttccaaacttcatggatgttttcacttggtccctgccatttgttggggaaa
aagtgactgagatgctggtgaatgtcctaaatatctgctcagatgatgaactagggtcag
aagaagatggatttgatggagcaacagctgcagcccgcaaagaggtgataaggaacaaga
tccgagcaataggcaaaatggcccgagtgttctcagtgctcagagaagagagtgagagcg
tgctgacgctgaaaggcttgactcccacgggcatgctccccagcggggtgctttctggag
ggaagcaaacgctgcaaagcgctatcaaaggattttcaccacagcataagatcactagct
tcgaggaggccaagggcttagaccgaattaatgaaaggatgccacctcgcagagatgcca
tgccctccgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggca
cggacagcaatggcagtaatagcagtaatattcagtga

KEGG   Manis javanica (Malayan pangolin): 108393196
Entry
108393196         CDS       T06054                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04728  Dopaminergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108393196 (PPP3CC)
   04310 Wnt signaling pathway
    108393196 (PPP3CC)
   04370 VEGF signaling pathway
    108393196 (PPP3CC)
   04020 Calcium signaling pathway
    108393196 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    108393196 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108393196 (PPP3CC)
   04218 Cellular senescence
    108393196 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108393196 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    108393196 (PPP3CC)
   04660 T cell receptor signaling pathway
    108393196 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    108393196 (PPP3CC)
   04659 Th17 cell differentiation
    108393196 (PPP3CC)
   04662 B cell receptor signaling pathway
    108393196 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108393196 (PPP3CC)
   04921 Oxytocin signaling pathway
    108393196 (PPP3CC)
   04924 Renin secretion
    108393196 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    108393196 (PPP3CC)
   04728 Dopaminergic synapse
    108393196 (PPP3CC)
   04720 Long-term potentiation
    108393196 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    108393196 (PPP3CC)
   04380 Osteoclast differentiation
    108393196 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108393196 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108393196 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    108393196 (PPP3CC)
   05020 Prion disease
    108393196 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    108393196 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    108393196 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108393196 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108393196 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    108393196 (PPP3CC)
   05163 Human cytomegalovirus infection
    108393196 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108393196 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108393196 (PPP3CC)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108393196 (PPP3CC)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     108393196 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 108393196
NCBI-ProteinID: XP_017509356
LinkDB
Position
Unknown
AA seq 534 aa
MSGRDVHLSTTERVVKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVREGRLEEEVALKI
INDGAAILRQEKTMVEVDAPITVCGDIHGQFFDLMKLFEVGGSPNNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKS
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEDHYISSYQKGGTTVRKEIIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVQAVEAREAIRGFSLQHRIRSFEEARGLD
RINERMPPRKDSQYPDGPVTLVTPVHPHTAHRSDKGRKASRDSESCCGTGGSKT
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgtccgggagggacgtccacctctccaccaccgagcgcgtcgtcaaagctgtccccttc
cctccaacacaacggcttactttgaaggaagtgtttgaaaatggaaaacctaaaattgat
gttttgaaaaaccatttggtgagggaagggcgactggaagaggaagtagccttaaagata
atcaacgatggggctgccatcctgagacaagagaagactatggtagaagtagacgctccg
atcacggtgtgtggtgacattcatggacaattctttgacctgatgaagttgtttgaagtt
ggaggatcacctaataatacacgttacctatttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttgtggagtttaaagattaatcatcctaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagagtatttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcttgtatggatacatttgactgt
cttcctcttgctgccctcttaaaccaacagtttctgtgtgtacatggagggatgtcacct
gaaattacttgtttagatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgcgacctgctttggtctgatccctcagaggattatggcaatgaaaagtcc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtataggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgctctccacacccctactggcttcca
aacttcatggatgttttcacgtggtctttgccttttgttggggagaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttccgatgatgaaattgaa
gatcactacatttcaagctatcagaaaggaggcaccacagttcgaaaggagatcatcaag
aataaaatcagagccattgggaagatggcgcgggtcttttcaattctgcgggaagagagt
gagagtgtgctgaccctcaagggcctgactcctacgggtacactccctctgggggtcctc
tcaggaggaaaacagaccattgagacggccacagtacaagcggtagaggcccgggaagca
atcagagggttttcacttcagcacaggatccggagttttgaagaagcccgaggtctggac
cgaatcaatgagcggatgccaccccgaaaagatagccagtaccctgatgggccagtgaca
ttggtgacccctgtacacccacacactgcacacaggagtgacaaggggagaaaagccagt
cgtgactcagagtcctgctgtggcacaggtggatccaagacttaa

KEGG   Manis javanica (Malayan pangolin): 108393727
Entry
108393727         CDS       T06054                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108393727 (PPP3R1)
   04310 Wnt signaling pathway
    108393727 (PPP3R1)
   04370 VEGF signaling pathway
    108393727 (PPP3R1)
   04020 Calcium signaling pathway
    108393727 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    108393727 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108393727 (PPP3R1)
   04218 Cellular senescence
    108393727 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108393727 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    108393727 (PPP3R1)
   04660 T cell receptor signaling pathway
    108393727 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    108393727 (PPP3R1)
   04659 Th17 cell differentiation
    108393727 (PPP3R1)
   04662 B cell receptor signaling pathway
    108393727 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108393727 (PPP3R1)
   04921 Oxytocin signaling pathway
    108393727 (PPP3R1)
   04924 Renin secretion
    108393727 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    108393727 (PPP3R1)
   04720 Long-term potentiation
    108393727 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    108393727 (PPP3R1)
   04380 Osteoclast differentiation
    108393727 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108393727 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108393727 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    108393727 (PPP3R1)
   05020 Prion disease
    108393727 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    108393727 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    108393727 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108393727 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108393727 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    108393727 (PPP3R1)
   05163 Human cytomegalovirus infection
    108393727 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108393727 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108393727 (PPP3R1)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     108393727 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 108393727
NCBI-ProteinID: XP_017510243
LinkDB
Position
Unknown
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaaaaagctt
gatttggacaattctggctctttgagtgtggaagagttcatgtctctgcctgagttacag
cagaatcctttagttcagcgagtaatagacatattcgacactgatgggaatggagaagta
gactttaaagaattcattgagggagtctctcagttcagtgtcaaaggagataaggagcag
aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg
gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagctacag
caaattgtagacaaaaccataataaatgcagataaagatggagatggaagaatatccttt
gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg
tga

KEGG   Manis javanica (Malayan pangolin): 108398753
Entry
108398753         CDS       T06054                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04728  Dopaminergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108398753 (PPP3CB)
   04310 Wnt signaling pathway
    108398753 (PPP3CB)
   04370 VEGF signaling pathway
    108398753 (PPP3CB)
   04020 Calcium signaling pathway
    108398753 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    108398753 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108398753 (PPP3CB)
   04218 Cellular senescence
    108398753 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108398753 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    108398753 (PPP3CB)
   04660 T cell receptor signaling pathway
    108398753 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    108398753 (PPP3CB)
   04659 Th17 cell differentiation
    108398753 (PPP3CB)
   04662 B cell receptor signaling pathway
    108398753 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108398753 (PPP3CB)
   04921 Oxytocin signaling pathway
    108398753 (PPP3CB)
   04924 Renin secretion
    108398753 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    108398753 (PPP3CB)
   04728 Dopaminergic synapse
    108398753 (PPP3CB)
   04720 Long-term potentiation
    108398753 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    108398753 (PPP3CB)
   04380 Osteoclast differentiation
    108398753 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108398753 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108398753 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    108398753 (PPP3CB)
   05020 Prion disease
    108398753 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    108398753 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    108398753 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108398753 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108398753 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    108398753 (PPP3CB)
   05163 Human cytomegalovirus infection
    108398753 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108398753 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108398753 (PPP3CB)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108398753 (PPP3CB)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     108398753 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 108398753
NCBI-ProteinID: XP_017518429
LinkDB
Position
Unknown
AA seq 489 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDERLIYGSKKV
GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQS
ATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATEN
HGTGNHSAQ
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgcgta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagaaaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctctatccaagcacattatttctactacgaggcaaccatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagcctgcctcttgctgcacttttaaaccaacaatttctt
tgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtctgatccttct
gaagattttggaaatgaaaaatcacaagaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattgaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtaacagaaatgttggtaaatgttctgagtatttgttctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgaacggctcatatatggcagtaaaaaagta
ggttcagctgcagcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatg
gcaagggtcttctctgttctcagggaggagagtgaaagtgtgctgacactcaagggcctg
actcccacagggatgttgcctagtggagtgttggctggaggacggcagaccctgcaaagt
gccacagttgaggctattgaggctgaaaaagcaatacgaggattctctccaccacataga
atctgcagttttgaagaggcaaagggtttggataggatcaatgagagaatgccaccccgg
aaagatgctgtacaacaagatggtttcaattctctgaacaccgcacatgccactgagaac
cacgggactggcaaccatagtgcccagtga

KEGG   Manis javanica (Malayan pangolin): 108404455
Entry
108404455         CDS       T06054                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04720  Long-term potentiation
mjv04724  Glutamatergic synapse
mjv04728  Dopaminergic synapse
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05152  Tuberculosis
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108404455
   04310 Wnt signaling pathway
    108404455
   04370 VEGF signaling pathway
    108404455
   04020 Calcium signaling pathway
    108404455
   04022 cGMP-PKG signaling pathway
    108404455
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108404455
   04218 Cellular senescence
    108404455
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108404455
   04650 Natural killer cell mediated cytotoxicity
    108404455
   04660 T cell receptor signaling pathway
    108404455
   04658 Th1 and Th2 cell differentiation
    108404455
   04659 Th17 cell differentiation
    108404455
   04662 B cell receptor signaling pathway
    108404455
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108404455
   04921 Oxytocin signaling pathway
    108404455
   04924 Renin secretion
    108404455
  09156 Nervous system
   04724 Glutamatergic synapse
    108404455
   04728 Dopaminergic synapse
    108404455
   04720 Long-term potentiation
    108404455
  09158 Development and regeneration
   04360 Axon guidance
    108404455
   04380 Osteoclast differentiation
    108404455
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108404455
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108404455
   05014 Amyotrophic lateral sclerosis
    108404455
   05020 Prion disease
    108404455
   05022 Pathways of neurodegeneration - multiple diseases
    108404455
  09165 Substance dependence
   05031 Amphetamine addiction
    108404455
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108404455
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108404455
   05170 Human immunodeficiency virus 1 infection
    108404455
   05163 Human cytomegalovirus infection
    108404455
   05167 Kaposi sarcoma-associated herpesvirus infection
    108404455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108404455
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108404455
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     108404455
SSDB
Other DBs
NCBI-GeneID: 108404455
NCBI-ProteinID: XP_017527546
LinkDB
Position
Unknown
AA seq 240 aa
MYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDV
FTWSLPFVGEKVTEMLVNILNICSDDELISDDEIEGGITVRKEIIKNKIRAIGKMARVFS
ILWEESESVLTLKGLTPMGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFE
EARGLDRVNERMPPRKDSQYPDGPVTLVTSVHPHTAHRSDKGRKASRDPESCYGTGGSKT
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtataggaagagccaaacaacaggctttccatcactcattacaattttctctgccccc
aattacctagatgtctataacaataaagctgctgtgttaaaatatgaaaacaatgtcatg
aatatcaggcagtttaactgttctccacacccctactggcttccaaacttcatggatgtt
ttcacgtggtctttgccttttgttggggagaaagtcacagagatgctggttaacattctc
aacatatgctctgatgatgaattgatttccgatgatgaaattgaaggaggcatcacagtt
cgaaaggagatcatcaagaataaaatcagagccattgggaagatggcgcgggtcttttca
attctgtgggaagagagtgagagtgtgctgaccctcaagggcctgactcctatgggtaca
ctccctctgggggtcctctcaggaggaaaacagaccattgagacggccacagtagaagcg
gtagaggcccgggaagccatcagagggttttcacttcagcacaggatccggagttttgaa
gaagcccgaggtctggaccgagtcaatgagcggatgccaccccgaaaagatagccagtac
cctgatgggccagtgacattggtgacctctgtacacccacacactgcacacaggagtgac
aaggggagaaaagccagtcgtgacccagagtcctgctatggcacaggtggatccaagact
taa

DBGET integrated database retrieval system