KEGG   Manis javanica (Malayan pangolin): 108387253
Entry
108387253         CDS       T06054                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04260  Cardiac muscle contraction
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04270  Vascular smooth muscle contraction
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04727  GABAergic synapse
mjv04728  Dopaminergic synapse
mjv04742  Taste transduction
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04924  Renin secretion
mjv04925  Aldosterone synthesis and secretion
mjv04927  Cortisol synthesis and secretion
mjv04929  GnRH secretion
mjv04930  Type II diabetes mellitus
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05031  Amphetamine addiction
mjv05410  Hypertrophic cardiomyopathy
mjv05412  Arrhythmogenic right ventricular cardiomyopathy
mjv05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108387253 (CACNA1C)
   04020 Calcium signaling pathway
    108387253 (CACNA1C)
   04024 cAMP signaling pathway
    108387253 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    108387253 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108387253 (CACNA1C)
   04929 GnRH secretion
    108387253 (CACNA1C)
   04912 GnRH signaling pathway
    108387253 (CACNA1C)
   04921 Oxytocin signaling pathway
    108387253 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    108387253 (CACNA1C)
   04924 Renin secretion
    108387253 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    108387253 (CACNA1C)
   04927 Cortisol synthesis and secretion
    108387253 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108387253 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    108387253 (CACNA1C)
   04270 Vascular smooth muscle contraction
    108387253 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    108387253 (CACNA1C)
   04727 GABAergic synapse
    108387253 (CACNA1C)
   04725 Cholinergic synapse
    108387253 (CACNA1C)
   04728 Dopaminergic synapse
    108387253 (CACNA1C)
   04726 Serotonergic synapse
    108387253 (CACNA1C)
   04720 Long-term potentiation
    108387253 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    108387253 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    108387253 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108387253 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108387253 (CACNA1C)
   05020 Prion disease
    108387253 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    108387253 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    108387253 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108387253 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    108387253 (CACNA1C)
   05414 Dilated cardiomyopathy
    108387253 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108387253 (CACNA1C)
   04934 Cushing syndrome
    108387253 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mjv04040]
    108387253 (CACNA1C)
Ion channels [BR:mjv04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108387253 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 108387253
NCBI-ProteinID: XP_017500959
LinkDB
Position
Unknown
AA seq 1904 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYSQEGIADVPAEDDPSPCALETGHGR
QCQNGTVCRPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIY
FVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIEPENEDEGAEEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSR
YWRRWNRFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALL
ALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRL
LRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKI
ELKSITADGESPRTTKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSE
LHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQ
HTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKLYICSDSSKQTEAECKGNYITYKDGEVDQPIVQARSWENSKFDFDNVLAA
MMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYL
MFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMVLKLIAFKPKGHFSDPWN
VFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMN
AEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAV
IGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESE
PSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDE
FKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTV
MFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVG
KFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRRAISGDLTAE
EELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHISKAGDS
QGTTESPSHERLVDSTFTPSSYSSTGSNANINNANNTALGRLPQPTGPPSAVSTMEGHWP
PLSPAVQGPEAAWKLSSKRCHSRESQMAMVCKEAVSQDEPCDMRMNEDTEYGSEPSLTCT
DLFSYQDDENRQLTPPEEDERDTRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQ
KTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFLRPCTTPPATPSGRGWPPQPIPTLRLEG
AESSEKLNSSFPSIHCGSWSGEPMHCDRGSGAIRRARPVSLTVPSQAAAQGRQFHGSASS
LVEAVLISEGLGQFAQDPKFIEVTTQELADACNMTIEEMENAADNILSGGAQQSPNGALL
PFVNCRDPGQDRAGGGEHQSCAAPLERGTSEEGAQDSRAFAGSL
NT seq 5715 nt   +upstreamnt  +downstreamnt
atggtacccctgctgcatatcgcccttctcgtgctgtttgtcatcatcatctacgccatc
atcggcctggagcttttcatggggaagatgcacaagacctgctacagccaggagggcata
gcagatgtcccagcggaagacgacccttcaccgtgcgcgctggagaccggccacgggcgg
cagtgccagaacggcacggtgtgcaggcccgggtgggacgggcccaagcatggcatcacc
aacttcgacaactttgccttcgccatgctgaccgtgttccagtgcatcaccatggagggc
tggaccgacgtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctat
tttgttacactaatcatcatagggtcattttttgtacttaacttggttctcggtgttctt
agcggggagttttccaaagagagggagaaggccaaggcgcggggagatttccagaagctg
cgagagaagcagcagctggaggaggacctcaaaggctacctggactggatcactcaggca
gaggacatcgagcctgagaatgaggatgagggcgcggaggaggagaagccgcgcaacatg
agcatgcccacgagtgagacggagtctgtcaacaccgaaaacgtggctggaggggacatc
gagggagaaaactgcggggccaggctggcccaccggatctccaaatcgaagttcagccgc
tactggcgccggtggaaccgattctgcaggagaaagtgccgcgcagcagttaagtccaac
atcttctactggcttgtgatcttcctggtgttcctcaacacactcaccatcgcctcggag
cactacaaccagccccactggctcacggaggtccaagacacggccaacaaggccctgctg
gcccttttcacggcggagatgctgctgaagatgtacagcctgggcctgcaggcctacttc
gtatccctgttcaaccgctttgactgcttcattgtgtgtggcggcatcctggagaccatc
ctggtggagaccaagatcatgtctcccttgggcatctctgtgctgcggtgcgtccggctt
ctgaggatattcaagatcacaaggtactggaactccttaagcaacctggtggcatccttg
ctgaattccgttcgttccattgcctctctgctgctgctcctcttcctcttcatcatcatc
ttctccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagacc
cggaggagcacatttgataactttccgcagtccctcctcaccgtgtttcagatcctgacc
ggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctctttt
ccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaattatatccta
ctgaatgtgttcttggccattgctgtggacaatctggctgatgctgagagcctcacatcc
gctcagaaggaggaagaagaagagaaggagaggaagaagctggccaggactgccagccca
gaaaagaagcaagaggtggtagagaagccagcagtggaggagaccaaggaggagaagatt
gagctgaagtccattacagctgatggagagtccccacgcaccaccaagatcaacatggat
gacctccagcccaatgaaaatgaggataagagtccttaccccaacccagaaactacagga
gaagaggatgaggaggagcccgaaatgcctgtgggcccccgcccacgaccactttctgag
ctgcaccttaaggagaaggcagtgcccatgccagaagccagtgcatttttcatctttagc
cccagcaacaggttccgcctccagtgccaccgcattgtcaatgacacgatcttcaccaac
ctgatcctcttcttcattctgctcagcagcatctccctggctgctgaggaccctgtccag
cacacctccttcaggaaccatattctgttttattttgatattgtttttactaccattttc
accattgaaattgctctgaagatgactgcttatggtgccttcctgcacaagggctctttc
tgccgtaactacttcaacatcctggacctgctggtggtcagtgtgtccctcatctccttc
ggcatccagtccagcgccatcaatgtcgtgaagatcctgcgggttctgcgagtgctcagg
cccctgagggccatcaacagggccaagggactaaagcacgtggtacagtgtgtgttcgtc
gctatccggaccattgggaacatcgtgattgtcaccactctgctccagttcatgttcgcc
tgcattggggtccagctcttcaagggaaagctctacatctgttcagatagctccaaacag
actgaggcggaatgcaagggcaactacatcacatacaaggatggggaggttgaccaaccc
atcgtccaggcgcgcagctgggagaacagcaagtttgactttgacaatgttctggcagcc
atgatggccctcttcactgtctccacatttgaggggtggccagagctgctgtaccgctcc
attgactcccacacagaggacaagggccccatctacaaccaccgtgtggagatctccatc
ttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggcttc
gtcatcgtcaccttccaagagcagggcgagcaggagtacaagaactgcgagctggacaag
aaccagcgacagtgtgtggaatatgccctcaaggcccggcctctgcggagatacatcccc
aagaaccagcaccagtacaaagtgtggtatgtggtcaactccacctactttgagtacctg
atgtttgtcctcatccttctcaacaccatctgcttagccatgcagcactatggccagagc
tgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggtctcttcactgtg
gagatggtcctgaagctcattgccttcaaacccaagggacactttagtgatccctggaat
gtctttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgagactaat
cactatttctgtgatgcatggaatacatttgacgccctgattgttgtgggtagcattgtt
gatatagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctttatgaac
gcagaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgccta
gtcaagctgctgagccgtggggagggcatccggaccctgctgtggaccttcatcaagtcc
ttccaggcgctgccctacgtggccctcctcatagtgatgctgttcttcatctatgccgtg
atcggcatgcaggtgtttgggaaaattgccctgaatgataccacagagatcaaccggaac
aacaattttcagaccttcccccaagctgtactactactcttcaggtgtgccacaggggag
gcatggcaggacatcatgctggcctgcatgccagggaagaagtgtgccccagagtcagag
cccagcaacagcacagaaggggaaacgccctgtggcagcagctttgccgtcttctacttc
atcagcttctacatgctctgtgccttcctgatcatcaacctctttgtggctgtcatcatg
gacaactttgactacctgacaagggactggtcaatccttggtccccaccatctggacgaa
tttaaaagaatttgggcagagtatgaccctgaagccaagggtcgtatcaaacacctagat
gtagtgaccttgctccggcggattcagcccccactgggtttcgggaagctgtgccctcac
cgtgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagcgacgggacagtt
atgttcaacgccaccctgtttgccctcgtccggacagccctgaggatcaaaacagaaggg
aacctggaacaagccaatgaggagctgcgggccataatcaagaagatctggaaacggacc
agcatgaagctgctggaccaggtggtgccccctgcaggcgatgatgaggtcacggttggc
aagttttacgctacattcctgatccaagagtacttccggaaattcaagaagcgcaaagag
cagggccttgtgggcaagccctcccagaggaacgcactgtccctccaggccggcttgcgc
acactgcatgacctcgggcctgagatccggcgggccatctccggagatctgacagccgag
gaggagctggacaaggccatgaaggaggctgtgtctgctgcctctgaagatgacatcttc
aggagggccggtggcctgttcggcaaccatgtcagctactaccaaagtgacggccggagc
gccttcccccagacctttaccacccagcgcccgctgcacatcagcaaggcaggcgacagc
cagggcaccaccgagtcgccgtcccacgagaggctggtggactccaccttcacgcccagc
agctactcctccaccggctccaacgccaacatcaacaatgccaacaacacagcactgggc
cgcctcccccagcccactggcccccctagtgcagtcagcaccatggagggccattggcct
cccttgtctcctgctgtccaggggccggaggcagcatggaagctcagctctaagaggtgt
cactcccgggagagccagatggccatggtgtgtaaggaggcggtctctcaggacgagccc
tgtgacatgaggatgaatgaggacacagagtatggcagcgagcccagcctgacctgcaca
gacctgttctcctaccaggatgatgaaaatcgacaattgacaccccctgaggaggatgag
agggacacccggcagtctccgaagaggggcttcctccgctccgcctccctcggtcgaagg
gcctccttccacctggaatgtctgaagcgacagaagaatcaagggggagacatctctcag
aagacagtcctgcccctgcacctggtccatcatcaggcattggcagtggcaggcctgagc
cccctcctccagagaagccattcacctaccacgttcctccggccgtgcaccaccccgcct
gccacgcccagtggccgaggctggcccccgcagcccatcccgaccctgcggctggagggg
gccgagtccagcgaaaaactcaacagcagcttcccgtccatccactgtggctcctggtct
ggggaacccatgcactgcgataggggcagtggcgccatccgaagagcccggcctgtgtcc
ctcaccgtgcccagccaggccgcggcccagggcaggcagttccacggcagcgccagcagc
ctggtggaagcggtcttgatttcagaaggactggggcagtttgctcaagatcccaagttt
atcgaggtcacaacccaggagctggcagacgcgtgcaacatgacaatcgaggagatggag
aacgctgctgacaacatcctcagtgggggcgcccagcagagccccaacggcgccctgctc
ccttttgttaactgcagggacccggggcaggacagagcagggggcggggagcaccagagc
tgtgcggcccccctggagcgtgggactagcgaggagggcgcgcaggacagcagagccttc
gccggcagcctgtag

DBGET integrated database retrieval system