KEGG   Manis javanica (Malayan pangolin): 108387307
Entry
108387307         CDS       T06054                                 

Gene name
SLC31A1
Definition
(RefSeq) high affinity copper uptake protein 1 isoform X1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108387307 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108387307 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108387307 (SLC31A1)
Transporters [BR:mjv02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   108387307 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 108387307
NCBI-ProteinID: XP_017501029
LinkDB
Position
Unknown
AA seq 179 aa
MNHSHHMGMTSMDHSNTTAAPHSHGMDDMMMMQMTFYFDYKNVELLFSGLVINTAGEMAG
AFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFP
HLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaaccattcccaccacatggggatgacctctatggaccacagcaatactactgcagcc
ccccactcccatggaatggacgacatgatgatgatgcagatgaccttctattttgactat
aagaatgtggagctattgttttctggtttggtgatcaatacggctggagaaatggctgga
gcctttgtggcagtgttcttactagcaatgttctatgagggactcaagatagcccgagag
agcctgctgcgcaagtcacaagtcagcattcgctataattccatgcctgtcccagggcca
aatggaaccatccttatggagacgcacaaaactgttgggcagcagatgctgagctttcct
cacctcctgcaaacagtgctgcatatcatccaggtggtcatcagctacttcctcatgctc
atcttcatgacttacaacgggtacctctgcattgcggtagcagcaggggctggcacaggc
tactttctcttcagctggaagaaggcagtggtagtggacatcacagagcattgccattaa

DBGET integrated database retrieval system