KEGG   Manis javanica (Malayan pangolin): 108388002
Entry
108388002         CDS       T06054                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04062  Chemokine signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05223  Non-small cell lung cancer
mjv05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108388002 (JAK3)
   04151 PI3K-Akt signaling pathway
    108388002 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108388002 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108388002 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108388002 (JAK3)
   04659 Th17 cell differentiation
    108388002 (JAK3)
   04062 Chemokine signaling pathway
    108388002 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388002 (JAK3)
   05203 Viral carcinogenesis
    108388002 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    108388002 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    108388002 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108388002 (JAK3)
   05161 Hepatitis B
    108388002 (JAK3)
   05162 Measles
    108388002 (JAK3)
   05169 Epstein-Barr virus infection
    108388002 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108388002 (JAK3)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108388002 (JAK3)
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108388002 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2
Other DBs
NCBI-GeneID: 108388002
NCBI-ProteinID: XP_017501877
LinkDB
Position
Unknown
AA seq 1098 aa
MAPPSEETPLISQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDMGTQVLVYRLRFCFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRFPVGLGLKEQGECLSLAVLDLARMAREQPQR
PEKLLKTVSYKVCLPPGLRDLIQGLSFVTRKRIRRTVGRALRRVAACQADRHSLMAKYIM
DLERLEPARAAETFVVGLPGAGGGQGAPGLLRVDGGSGVAWSPGGQEVLQPFCDFPEIVD
ISIKQALRAGPAGEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSRHYFC
KEVAPPRLLEEVVEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIQRDPSGTFSLAGLGRPHSSLRELLTACWDGGLHVDGVALNLTFCCTPRPK
EKSNLIVVRRGCSLPTSSPVQSQSQCQLSQMTFHKIPTDSLEWYENLGHGSFTKIYRGCR
HEAVDGEAWETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVCLGALDTYLRKCGHLVSATWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLHEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYEERQQLPAPKWVELALLIEQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIHILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPCGCLRDFLQRHRARLNAGRLLLYASQICKGMEYLGSRRCVHRDLAARPPSPHLP
PSFAQGCPRSVLCPTSHLKTALSAPPRYAPESLSDNIFSRQSDVWSFGVVLYELFTYGDK
SCSPSAEFLRMMGCDRDVPALCRLLELLAEGLRLPAPPACPAEVHELMKLCWAPSPQDRP
PFSTLGPQLDALWSGSQG
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacccctgatctctcagcgctcctgtagcctctcatct
tcagaggctggtgccctccatgtgctgctgccccctcggggccctggacccccacagcgc
ctatccttctcttttggggaccactcggctgaagagctgtgtgtctgggctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccaagccacatcttctccgtggaggacatgggtacccaggttcttgtctac
aggcttcgcttttgcttccccaactggtttgggctagagaagtgccaccgctttggacta
cgaaaggacttggccagtgccatccttgacttgccagtcctggagcacctctttgcccag
caccgcaacgacctggtgagcggccgcttccccgtgggcctcggcctcaaggagcagggt
gaatgtctcagcctggccgtgctggacttggcccggatggcccgtgagcagccccagcgg
cccgagaagctgctgaagaccgtcagctacaaggtctgcttgccccccggccttcgagac
ctgatccagggcctgagtttcgtgacgcggaagcgtatccggaggaccgtgggccgggcc
ctgcgccgcgtggccgcctgccaggctgacaggcactcgctcatggccaagtacatcatg
gacctggagaggctggaaccggccagggccgccgagaccttcgtcgtgggcctccccggg
gctggtggaggtcagggtgcacccgggctgctccgcgtggatggtggcagcggcgtggct
tggagtccaggaggacaggaggtccttcaacccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggccctgcgcgctggccctgccggggagcaccgactagtcaccatc
accaggacagacaaccagattctggaggccgagttcccggggctgcccgcggccttgtct
ttcgtggcgctggtggacggctacttccgactgaccaccgactcccggcactacttctgc
aaggaggtcgccccaccacggctgctggaggaggtggtggaacagtgccacggccccatc
accctggattttgccatcaacaagctcaagactgggggctcacttcccggctcctatgtt
ctccgccgtagcccccaggattttgacagtttcctgctcactgtctgtgtccagacccct
ctaggccctgattacaagggctgcctcatccagcgcgacccctcaggaaccttctccctg
gctggccttggccgtccccacagcagtcttcgagagctcctgacagcctgctgggatggt
gggctgcatgtggatggggttgcactgaacctcaccttctgctgcactcccagacccaaa
gaaaagtccaacctgattgtggtccggaggggttgcagcttgcccacatcatcccctgtt
cagtcccaatcccaatgccagctgagtcagatgacatttcacaagatccccaccgacagc
ctggagtggtatgagaacctgggacatggatccttcaccaagatttaccggggctgtcgc
catgaggccgtggatggagaagcctgggagacagaggtgctgctcaaagtgatggatgcc
aagcataaaaactgcatggagtcattcctggaagcagcaagcttgatgagccaagtgtca
taccaacatcttgtgctgctccacggcgtgtgcatggctggagacagcatcatggtgcag
gaatttgtgtgtctgggagcgctagacacatatctgcgcaagtgtggccacctggtgtca
gccacctggaagctgcaggtgatcaaacagctggcctatgccctcaactatttggaagac
aaaggtctcccccatggcaatgtatcagcccggaaggtgctcctggctcgggagggggct
gatgggaacccacctttcatcaaacttagtgaccctggggtcagccccactgtgctaagc
ctggaaatgctcactgacaggatcccttgggtggcccccgagtgtcttcatgaggcccgg
acacttggcttggaagctgacaagtggggctttggtgccaccgtctgggaggtgttcagc
ggtgtcacgatgcccatcagcaccctggaccccgctaagaagctccagttttacgaggaa
cgtcaacagctgcctgcccccaagtgggtggagctggccctgctcatcgaacaatgcatg
gcttacgagccaggccagaggccctccttccgcgcggtcatccgggacctgaacagcctc
atcacatcagattatgagctcctctctgaccccacacctggtgccctggcgccccgtgat
gggctgtggaatggtgcccagctctatgcctgccaggaccctaccatctttgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggtagcgtggaactgtgccgc
tatgacccactgggcgacaacacaggcgccctggtggccgtgaagcagctgcagcacagt
gggccagaccagcagagggatttccagcgcgagatccacatcctcaaggctctccacagt
gacttcattgtcaagtaccgcggagtcagctacggcccaggccgccagagcttgcggctg
gtcatggagtacctgccctgcggctgtttgcgagacttcctgcagcggcaccgcgcgcgc
ctgaacgccggccgcctgcttctctacgcctcccagatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcagcgcgtccccccagcccccaccttccg
ccgtccttcgcccagggctgcccccgttccgtcctgtgccccacctcgcacctcaagacg
gccctgtccgcaccccccaggtacgccccggagtccctctcggacaatattttctcgcgc
cagtcggatgtctggagcttcggggtcgtcctgtacgagctcttcacttacggcgacaag
agctgcagcccctccgccgagttcctgcgcatgatgggctgtgaccgagacgtccctgct
ctctgccgcctcctggagctgctggctgagggcttgagactgccggcgcctcctgcctgc
cctgctgaggttcatgagctcatgaagctgtgctgggcccctagcccacaagaccggcct
ccatttagcaccctgggaccccagctggatgcactgtggagtggaagccaggggtag

KEGG   Manis javanica (Malayan pangolin): 108388836
Entry
108388836         CDS       T06054                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04062  Chemokine signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04725  Cholinergic synapse
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05140  Leishmaniasis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108388836 (JAK2)
   04151 PI3K-Akt signaling pathway
    108388836 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108388836 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108388836 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108388836 (JAK2)
   04659 Th17 cell differentiation
    108388836 (JAK2)
   04062 Chemokine signaling pathway
    108388836 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108388836 (JAK2)
   04917 Prolactin signaling pathway
    108388836 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    108388836 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    108388836 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388836 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108388836 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108388836 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108388836 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108388836 (JAK2)
   05164 Influenza A
    108388836 (JAK2)
   05168 Herpes simplex virus 1 infection
    108388836 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108388836 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108388836 (JAK2)
   05140 Leishmaniasis
    108388836 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108388836 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108388836 (JAK2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108388836 (JAK2)
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108388836 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kdo Kinase-like RIO1 APH
Other DBs
NCBI-GeneID: 108388836
NCBI-ProteinID: XP_017502882
LinkDB
Position
Unknown
AA seq 510 aa
ILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMHFLEEKALTHGNVCAKNILLI
REEDRKIGNPPFIKLSDPGISMTVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTT
LWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELANLINNCMDYEPDFRPSFRAII
RDLNSLFTPDYELLTENDMLLNMKIGALGFSGAFEDQDPTQFEERHLKFLQQLGKGNFGS
VEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGR
RNLRLIMEYLPYGSLRDYLQKHKERIDHNKLLQYTSQICKGMEYLGTKRYIHRDLATRNI
LVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGV
VLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYVIM
TECWNNNVNQRPSFRDLALRVDQIRDTMAG
NT seq 1535 nt   +upstreamnt  +downstreamnt
atatcctggttcaggagtttgtaaaatttggatcattagatacatatctgaaaaagaata
aaaattctataaatatattgtggaaacttgaagtggctaaacagttggcatgggccatgc
attttctagaagaaaaagcccttactcatgggaatgtgtgtgccaaaaatattctgctta
tcagagaagaagacaggaagataggaaatccacctttcatcaaacttagtgatcctggca
ttagtatgacagttttgccaaaggacattcttcaggagagaataccatgggtgccacctg
aatgcattgaaaatcctaaaaatctaaacttggcaacagacaaatggagttttggtacca
ctttgtgggaaatctgcagtggaggagataagcctttgagtgctttggattctcaaagaa
agctacagttttatgaagataggcaccagcttcctgcaccaaagtggacagaattagcaa
atctcattaataattgtatggattatgaaccagattttagaccttctttcagagccatca
tacgagatcttaatagcttgtttactccagattatgaattattaacagaaaatgacatgt
tactgaatatgaagataggtgccctagggttttctggtgcttttgaagaccaagacccta
cacagtttgaagagagacacttgaaatttctacagcaacttggcaagggtaattttggga
gtgtggagatgtgccggtatgaccctctacaagacaacactggggaggtggtggctgtaa
aaaagctccaacacagtactgaagagcacctcagagactttgaaagggaaattgaaatcc
ttaaatctttgcagcatgacaacattgtaaagtacaagggagtatgctacagtgctggcc
ggcgtaatctaagattaattatggaatatttaccatatggaagtttgcgagactatctcc
aaaaacataaggaacggatagatcataacaaacttctgcagtacacatctcagatatgca
agggtatggagtatcttggtacaaaaaggtatatccatagggatctggcaacaaggaata
tattggtggagaatgaaaacagagttaaaattggggattttgggttaactaaagtcttgc
cacaagacaaagaatactacaaagtgaaagaacctggtgaaagtcctatattctggtatg
ctccagagtcactcacagagagcaagttttctgtagcctcagatgtttggagctttggag
tggttctgtatgagcttttcacatatattgagaagagtaaaagtccaccagcggaattta
tgcgtatgattggcaatgacaaacaaggacagatgattgtgtttcatttgatagaactcc
tgaagaataacggaagattaccaagaccagacgggtgcccagatgagatttatgtgatta
tgacagaatgctggaacaataatgtaaatcagcgcccctctttcagagatctagctcttc
gagttgatcaaataagggacaccatggctggatga

KEGG   Manis javanica (Malayan pangolin): 108395333
Entry
108395333         CDS       T06054                                 

Definition
(RefSeq) tyrosine-protein kinase JAK2-like
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04062  Chemokine signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04725  Cholinergic synapse
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05140  Leishmaniasis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108395333
   04151 PI3K-Akt signaling pathway
    108395333
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108395333
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108395333
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108395333
   04659 Th17 cell differentiation
    108395333
   04062 Chemokine signaling pathway
    108395333
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108395333
   04917 Prolactin signaling pathway
    108395333
   04935 Growth hormone synthesis, secretion and action
    108395333
  09156 Nervous system
   04725 Cholinergic synapse
    108395333
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108395333
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108395333
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108395333
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108395333
  09172 Infectious disease: viral
   05161 Hepatitis B
    108395333
   05164 Influenza A
    108395333
   05168 Herpes simplex virus 1 infection
    108395333
   05167 Kaposi sarcoma-associated herpesvirus infection
    108395333
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108395333
   05140 Leishmaniasis
    108395333
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108395333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108395333
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108395333
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108395333
SSDB
Motif
Pfam: FERM_F2 Jak1_Phl FERM_F1 PK_Tyr_Ser-Thr SH2 Pkinase
Other DBs
NCBI-GeneID: 108395333
NCBI-ProteinID: XP_017512997
LinkDB
Position
Unknown
AA seq 538 aa
MFALMSETERIWYPPNHVFHIDESTRHNVLYRLRFYFPYWYCNGSKRAYRHGVSRGTEAP
LLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLDIYSS
ISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQFSHCKATARNLKLKYLINLETLQS
AFYTEQFEVKEPGRGPSGEEIFATIVITGNGGIQWSRGKLKESETLTEQDLQLYCDFPDI
IDVTIKQASQEVSNESRIVTIHKQDGKNLEIELSSLRAALSFVSLIDGYYRLTADAHHYL
CKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVER
ENVIEYKHCLITKNENGEYNLNGTKKNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKL
KDKSNLLVFRTNGLSDVPTSPTLHRHNNVNQMVFHKIRNEDLTFNESLGQGTFTKIFKGV
RREVGDYDQLHETEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEE
NT seq 1615 nt   +upstreamnt  +downstreamnt
atgtttgctttaatgagtgaaacagagaggatctggtatccacctaatcatgtcttccat
atagatgaatcaaccaggcacaatgtactctacagattaaggttttactttccttattgg
tattgtaacggcagcaagagagcttaccgacacggggtctctcgtggcactgaagccccg
cttcttgatgactttgtcatgtcttacctttttgctcagtggcggcatgattttttgcat
gggtggataaaagtacctgtgactcatgagacacaggaagaatgtcttggaatggcagtg
ttagatatgatgagaatagccaaagagaaggaccagaccccactggacatctatagttct
atcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagactatcatatt
ttgacaaggaagagaataaggtacagatttcgcagattcattgagcaattcagccattgt
aaagccactgccagaaacttgaaacttaagtatcttataaatctggaaactcttcagtct
gccttctacacagagcagtttgaagtaaaagaacctggaagaggtccttcaggtgaggag
atttttgcaaccattgtaataactggaaacggtggaattcagtggtcaagagggaaactt
aaagaaagtgagacactgacagaacaggatttacagttatattgtgattttcctgatatt
attgatgtcactattaagcaagcaagccaagaagtttcaaatgaaagcagaattgtaact
atccataagcaagatggtaaaaatctggaaattgaacttagctcattaagagcagctttg
tcttttgtatcattaattgatggatattatagattaactgcagatgcacatcattacctc
tgtaaagaagtagcacctccaatggtgcttgaaaacatacaaagcaactgtcatggccca
attttaatggattttgccatcagtaaactgaagaaagcaggaaatcagactggactttat
gtacttcgatgcagtcctaaggactttaataaatattttctgacttttgctgtcgagcga
gaaaatgtcattgaatataagcactgtttgattacaaaaaatgagaatggagaatacaac
ctcaatgggactaagaagaacttcagtaatcttaaagatcttctgaattgctaccagatg
gaaactgttcgctcagacagtataatattccagtttacaaagtgctgtcccccaaagctg
aaagataaatcaaaccttctagtcttcagaactaatggtctttctgatgtaccaacctca
ccaacgttgcacaggcataataatgtgaaccaaatggtgtttcacaaaattagaaatgaa
gatttgacatttaatgaaagccttggccaggggacttttacaaaaatttttaaaggtgta
cgaagagaagtaggagactatgatcaattgcatgaaacagaagttcttttaaaagttctg
gataaagcacatagaaactattcagagtctttctttgaagcagcaagcatgatgagccag
ctttctcacaaacatctggttttaaactatggagtatgtgtctgtggagaggaga

KEGG   Manis javanica (Malayan pangolin): 108397113
Entry
108397113         CDS       T06054                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05145  Toxoplasmosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108397113 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108397113 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108397113 (TYK2)
   04658 Th1 and Th2 cell differentiation
    108397113 (TYK2)
   04659 Th17 cell differentiation
    108397113 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108397113 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    108397113 (TYK2)
   05160 Hepatitis C
    108397113 (TYK2)
   05171 Coronavirus disease - COVID-19
    108397113 (TYK2)
   05164 Influenza A
    108397113 (TYK2)
   05162 Measles
    108397113 (TYK2)
   05168 Herpes simplex virus 1 infection
    108397113 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108397113 (TYK2)
   05169 Epstein-Barr virus infection
    108397113 (TYK2)
   05165 Human papillomavirus infection
    108397113 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108397113 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108397113 (TYK2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108397113 (TYK2)
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108397113 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 108397113
NCBI-ProteinID: XP_017515850
LinkDB
Position
Unknown
AA seq 1220 aa
MGGGVSVAIRWLLPVAAGRGPGFEPESPGKAKPAVKSMPLWHRRPATRASKPDEDETQPL
ATRGGLKVLLHWAGPGGGEPWVTFSEATLTAEEVCIHIAHKVGITPPCFNLFALFDAQAQ
VWLPPNHVLEVSRDISLTLYFRMRFYFRNWHGMNPQEPAVYRCAPPGTEASSEQAEQGVQ
LLDPASFEYLFEQGKHEFVNDVASLWELSNEEEIHHFKNESLGMAFLHLCHFAVCHGVPL
EKVAKKISFKDCIPRSFRLQIQQHNALTRLRLRSIFRRFLQAFQPGRLSQQVIMVKYLAT
LEQLAPRFGTERVPVCHLEPLARAEGEPCYIRDSSRAPPEPQPESAARAPTHEVLVTGTG
GIQWRQMEAEGPRGDGGGSSRNCHAGPFGKKAKAQEVGSQPADRPQEAPWTDFCDFRDIT
HVVLKERHVSVHCQDKCLELTLPSRAAALSLVSLVDGYFRLTADSSHYLCHEVAPPRLVM
SIQDGIHGPLMEPFVLAKLQPEDGLYLIHWSTSHLSRLILTVAQRDQAPGAGCLRLRRFP
IKLQAGVFRLEGWDRSFPSARELRAALQGCSLRTGNDCFSLRRCCLPRPGEISNLIIMRG
PRAKTRPLNLSQLSFHRICQDDITQLSHLGQGTRTNVYEGLLRVGGQGPKEGRADGGDSP
LPSGGRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHVHLAFMHGVCVHGSENIMVT
EFVERGPLDVWLRRERGHVPVAWKVVVAQQLASALSYLEDKSLVHGNVCGRNILLARLGL
AEGTSPFIKLSDPGVGLSVLSREERVERIPWTAPECLSGGANSLSTAADKWGFGATLLEI
CFDGEAPLQGRGPSEKERFYQKQHQLPEPSCPDLATLTSQCLTYEPAQRPSFRTILRDLT
RLQPQNLVDVLAVNPDSSASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMV
AVKALKAGCGPQLRRGWRREIDILRTLYHEHIVKYKGCCGDQGEKSVQLVMEYVPLGSLR
DYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKA
VPEGHEYYCVREDGDSPVFWYAPECLKECKFYYSSDVWSFGVTMYELLTYCDSSQSPPSK
FIELIGLTQGQMTVLRLTEVLERGERLPRPEKCPCEIYVLMKNCWEADASFRPTFQNLIP
ILKMAHEKYQGQPPSVFSVC
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggaggcggtgtctcggtggcgatcagatggctgctgccggtggcagcggggcggggt
cccgggttcgagcctgagtccccgggcaaggccaagccagctgtcaagagcatgccactg
tggcaccggaggcccgccaccagggccagcaagcccgatgaagatgaaactcagcccctg
gccaccagaggtggtctgaaggtccttctgcactgggctggccctggtggtggggagccc
tgggtcaccttcagtgaggccacactgactgcagaggaggtctgcatccacattgcacac
aaagttggcatcactcctccctgcttcaatctctttgccctctttgatgctcaggcccag
gtctggctgcccccaaaccatgtcctggaggtctccagagacataagcctgacattgtac
ttccgtatgaggttttatttccggaactggcatggcatgaatcctcaggagccggctgtg
tatcgctgtgcacccccagggactgaggcttcctcagaacaggcagagcagggggtgcaa
ctcctggacccagcctcctttgagtacctctttgagcagggcaagcatgagtttgtaaat
gatgtggcatcactgtgggagctgtcaaatgaagaagagatccaccactttaagaacgag
agtctgggcatggcctttcttcacctctgccactttgctgtctgccacggtgttcccctg
gagaaggtggccaagaaaatcagcttcaaggactgcatcccacgctccttccgcctgcag
atccagcagcacaatgcgctgacccggttgcgcctacggagcatcttccgcaggttcctg
caggccttccagccaggccgcctctcccagcaggtcatcatggtcaagtacctggccaca
ctcgagcagctggcgccccgcttcggcacagagcgcgtgcccgtgtgccacctggagccg
ctggcccgggcggagggagagccctgctacatccgggacagcagccgggcccctccggag
ccccagcccgagtccgccgccagagcccccacccatgaggtgctggtgacgggcactggt
ggtatccagtggcggcagatggaggcagagggtccccgtggtgatggcgggggcagcagc
cggaattgccatgctggcccatttgggaagaaagctaaggcccaagaggtgggcagccag
ccagcggacaggcctcaggaggcaccgtggactgacttctgtgacttccgggacatcacc
cacgtggtgctgaaagaacgccacgtcagcgtgcactgtcaggacaagtgcctggagctg
accctgccttcccgggctgcagccctgtccttggtgtcgctggtggatggctatttccgc
ctgacagctgactcaagtcactacctgtgccacgaggtggcccctccacggctggtgatg
agcatccaggacggcatccacgggcccctgatggagccattcgtgctggccaagctgcag
cctgaggatggcctctacctcatccactggagcaccagccacctcagccgcctcatcctc
acggtggcgcagcgcgaccaggcacctggcgccgggtgcttgcgtctgcgcaggttcccc
atcaagctgcaggctggggtcttcaggctagagggctgggaccggtccttccccagcgcg
cgggagctgcgggctgccctgcaaggctgctcgctgcggaccggcaacgactgcttctcc
ttgcgccgctgctgcctgccacggccaggagaaatctccaatctcatcatcatgcgggga
cctcgggccaaaaccaggccactcaacctcagccagctcagcttccaccggatctgccag
gacgacatcacccagctgtcccacctgggccagggcaccaggaccaacgtgtatgaaggc
ctcttgcgagtggggggccaaggccccaaggagggcagggcagatggtggggactctccc
ttgcccagcgggggccgcgggcaagaactgcgagtggtactcaaggtgctggaccccagc
catcacgacatcgccctggccttctatgagacagccagcctcatgagccaggtctcccac
gtgcacctggccttcatgcatggcgtctgcgtgcatggctccgagaacatcatggtgacg
gagttcgtggagcgtgggcccctggatgtgtggctgcggcgggagaggggccatgtacct
gtggcctggaaggtggtggtggcccagcagctggccagcgccctcagctacctggaagac
aagagcctggttcatggaaatgtgtgtggccggaacatcctgctggcacggctggggctg
gcggaaggcaccagcccattcatcaagctgagtgaccccggagtgggtctgagtgtcctc
tccagggaggagcgggtagagcggatcccctggacagcgcccgagtgcctgtctggtggg
gccaatagcctaagcactgcggctgacaagtggggctttggcgccactctgctggagatc
tgcttcgacggggaggcccccctgcagggccgtggcccctctgagaaagagcgcttctac
cagaagcagcaccagctgccagagccctcttgcccagacctggcaacgctcaccagtcaa
tgcctgacctacgagccggcacagcggccgtctttccgtaccatcctgcgggacctcact
aggctgcagccccagaatctcgttgacgtcttggcggtgaacccggactcgtcagcgtca
gaccccacggtttttcataagcgctatttgaagaagatccgggatctgggcgagggccac
tttggcaaggtcagcctgtactgctacgacccgaccaacgacggcactggcgagatggtg
gccgtcaaggccctcaaggctggctgcgggccccagcttcgcaggggctggaggcgggag
atcgacatcctgcgcacgctgtatcacgagcacatcgtcaagtacaagggctgctgcggg
gatcaaggcgagaaatccgtgcagctcgtcatggagtacgtgcctctgggcagcctccga
gactacctgccccggcacagcgtcgggctggcccagcttctgctcttcgcccagcagatc
tgcgagggcatggcctacctacacgcacagcactacatccatcgcgacctggctgcccgc
aacgtgttgttggacaacgacaggctggtcaagatcggggactttggcctagccaaggct
gtgcctgaaggccatgagtactactgcgtgcgagaggatggggacagccccgtgttctgg
tacgccccagagtgcctaaaggaatgtaagttctactattcatctgacgtctggtctttt
ggagtcaccatgtatgagctcctgacctactgtgactccagtcagagccctccttcgaaa
ttcatcgaactcatcggcctcacgcagggacagatgacggtgctgaggctcaccgaggtg
ctggaacgaggggagaggctgcctcggccggagaaatgtccctgtgagatctacgtcctg
atgaagaactgctgggaggccgacgcctcattccgccccaccttccagaacctcataccc
atcctcaagatggcccacgagaagtaccaaggccagcccccctcagtgttcagcgtgtgc
tga

KEGG   Manis javanica (Malayan pangolin): 108405993
Entry
108405993         CDS       T06054                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04151  PI3K-Akt signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05140  Leishmaniasis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05212  Pancreatic cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405993 (JAK1)
   04151 PI3K-Akt signaling pathway
    108405993 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108405993 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108405993 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108405993 (JAK1)
   04658 Th1 and Th2 cell differentiation
    108405993 (JAK1)
   04659 Th17 cell differentiation
    108405993 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108405993 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108405993 (JAK1)
   05203 Viral carcinogenesis
    108405993 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108405993 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108405993 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108405993 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108405993 (JAK1)
   05161 Hepatitis B
    108405993 (JAK1)
   05160 Hepatitis C
    108405993 (JAK1)
   05171 Coronavirus disease - COVID-19
    108405993 (JAK1)
   05164 Influenza A
    108405993 (JAK1)
   05162 Measles
    108405993 (JAK1)
   05168 Herpes simplex virus 1 infection
    108405993 (JAK1)
   05163 Human cytomegalovirus infection
    108405993 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108405993 (JAK1)
   05169 Epstein-Barr virus infection
    108405993 (JAK1)
   05165 Human papillomavirus infection
    108405993 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108405993 (JAK1)
   05140 Leishmaniasis
    108405993 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108405993 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108405993 (JAK1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108405993 (JAK1)
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   108405993 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 108405993
NCBI-ProteinID: XP_017529936
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLLLGIGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKIWYAPNHTITVDDKTTLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLVISSENEMN
RFHPNDSGNILYYEVMVTGNLGIQWRQKPNVITVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKECVVSINKQDNKKMELKLYSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGGEEGMYVLRWSCTDFDNILMTVT
CFEKSEMLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQSEHLGRGTRTHIYSGT
LVDFKDDEGASEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDCKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPQTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaagtgaatctggaggcccctgaaccaggggtagaagtgctcttc
tatctgtctgatagggagccactcctgctgggcatcggagaatacacggcagaggagctg
tgcatcagggctgctcaggaatgctgtatctctcctctttgtcacaacctctttgccctg
tatgatgagaacaccaagatttggtatgctcctaatcacaccatcactgttgatgataag
acaacactccggctccactaccggatgaggttttatttcaccaattggcatgggaccaat
gataatgagcagtcagtatggcgacattctccaaaaaagcagaaaaatggctatgagaaa
aaaaaagttccagatgcaactcccctccttgatgccagctccctggagtatctgtttgct
caggggcagtatgatttggtcaaatgcctggctcccattcgagaccccaagactgagcag
gatgggcacgacatcgagaatgagtgtcttggaatggctgtcctggccatctcccactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttcttaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagactatttgtgacagcagt
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgttagtgatttcatcagaaaatgagatgaat
cgatttcatccaaatgacagtggaaacattctctactatgaagtgatggtaactggaaat
cttggaattcagtggaggcagaaaccaaatgttataactgttgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaagagaaaaacaaaatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtgt
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctattcccatgag
gaggccttgtcctttgtgtccctggtagacggctacttccggcttacagcagacgcccat
cattacctctgcaccgatgtggctcccccgttgattgtccacaacatacagaatggttgt
catggtccaatctgcacagaatatgccatcaataaattgcggcaagaaggaggtgaagag
gggatgtacgtgctaaggtggagctgcactgacttcgacaacattctcatgaccgtcacc
tgctttgaaaagtctgagatgcttggtggccagaaacagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctcagaccgcagcttccccagtctgggggac
ctcatgagccacctcaagaagcagattctgcgcacggacaacatcagctttgtgctgaag
cggtgttgccagcccaagccccgagaaatctccaatctgctggtggctactaagaaagct
caggagtggcagcctgtctatcccatgagccagctgagtttcgatcggatcctcaagaaa
gatattgtgcaaagtgagcaccttgggagaggcacacggacacacatctactctgggacc
ttggtggatttcaaggatgatgaaggagcttctgaagagaagagaatcaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggctttttttgaggcagccagcatg
atgagacaggtctcgcacaaacacatcgtatacctctatggcgtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggggggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccatggaagttcaaagttgccaagcagctggctagtgcc
ctgagttacttggaggataaggacctggtccatggaaatgtgtgcactaaaaacctcctc
ctggcccgtgagggcattgacagcgagtgtggcccgttcatcaagctcagtgaccccggc
atccccattactgtactgtccaggcaagagtgcatagaacgaatcccgtggattgctcct
gagtgtgtggaagactgcaagaacctgagcgtggccgcagacaaatggagctttggaacc
accctctgggaaatctgctacaatggcgagatccccctgaaagacaagacactgatcgag
aaagagagattctatgaaagccgatgcaggccagtgacaccatcttgtaaggagctggct
gaccttatgacccgctgcatgaactatgaccccaatcagagacctttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacattgtttcagagaaaaagcca
caaactgaagtggatcccacacattttgaaaagcggttcttaaagagaatccgtgacttg
ggagagggccactttgggaaggttgagctctgcaggtatgaccctgagggggacaatacg
ggggagcaggtagctgtcaaatccctgaagcctgagagtggtggtaaccacatagctgat
ctgaagaaggaaatagaaatcttaaggaacctctatcatgagaacattgtgaagtacaaa
ggcatctgtacggaagacggaggaaatggcattaagctcatcatggaatttctgccttcg
ggaagccttaaagagtatcttccaaagaataagaacaaaataaacctcaaacagcagttg
aaatatgctgttcagatttgtaaggggatggactacttgggttctcggcagtatgttcac
cgggacttagcagcgagaaatgtccttgttgagagtgaacaccaagtgaaaattggagac
tttggtttaaccaaagcaattgaaactgataaggagtactacacagtcaaggacgaccgg
gacagccctgtgttttggtatgctccagagtgtttgattcagtgtaaattttatatcgcc
tctgatgtctggtcttttggagtaactctgcacgagctgcttacttactgtgattcagat
tccagtcccatggcgttgttcctgaaaatgataggtccaactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgcccacctaactgtcca
gatgaggtttatcaacttatgagaaaatgctgggaattccaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system