KEGG   Manis javanica (Malayan pangolin): 108388120
Entry
108388120         CDS       T06054                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108388120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108388120
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mjv03310]
    108388120
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    108388120
Nuclear receptors [BR:mjv03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   108388120
SSDB
Motif
Pfam: GCR
Other DBs
NCBI-GeneID: 108388120
NCBI-ProteinID: XP_017502026
LinkDB
Position
Unknown
AA seq 400 aa
MDPKESLSSPSREEIPSSVLGRERANVMDFYKSLRGGAAAKVSASSPSLAAAAQADSKQQ
RTLADFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNELGLPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKSSASAAVSAAPTEKEFPKTNSNVSSEQQNMKGQPGTNGG
NVKLYTTDQSTFDIWRKKLQDLEFSSESPGKETSESPWRSDILIDESCLLSPLAGEDDPF
PLEGNSSEDCKPLILPDTKPKIKDNGDLILSSPNTGPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGPNIISNKMSAISVHGVSTSGGQMYHYDMNTAALSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDSLTSLGTLNFPGRSVFSNGYSR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcactgagctcccccagtagagaagaaatccccagcagtgtgctc
ggtcgggagagggcaaatgtgatggacttctacaaaagcctgcggggaggagctgcggcc
aaggtttctgcctcctcgccgtcactggctgctgctgcgcaggccgactcgaagcagcag
agaacactggctgattttccaaaaggctcaggaagcaatgcacagcagccagatctgtcc
aaggcagtctcactctcaatgggactgtatatgggagaaacagaaacaaaagtgatggga
aatgagctgggactcccacagcagggccaaatcagcctttcctctggggaaacagatttc
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagcgttccagagaacccc
aaaagttcagcatctgctgctgtttctgctgcccccacagaaaaagagtttccaaaaact
aactctaatgtgtcttcagaacagcagaatatgaagggccagcctggcaccaacgggggc
aatgtgaagttgtacaccacagaccaaagcacctttgacatttggagaaaaaaactccag
gacttggagttttcttctgagtccccaggtaaagaaacgagtgagagcccttggagatca
gacatcttgatagatgaaagctgtctgctttctcctttggccggagaggatgatccgttc
cctttggaaggaaactcaagtgaggactgtaagcctctcattttaccagacactaagcct
aaaattaaggataatggagatctgatcttatcaagccccaacactgggccactgccccaa
gtgaaaacagaaaaagaagatttcattgagctctgcacccctggggtaattaagcaagag
aaactgggcccagtttactgtcaggcaagcttttctgggccaaatataattagtaataaa
atgtcagccatttctgttcacggtgtgagcacctccggaggacagatgtaccactatgac
atgaatacagcagccctctctcagcagcaggatcagaagcctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccagggttctggagatgacagcctg
acttccttggggaccctgaacttccccggtcgatcggttttttctaacggttattcgagg
taa

DBGET integrated database retrieval system