KEGG   Manis javanica (Malayan pangolin): 108388206
Entry
108388206         CDS       T06054                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04915  Estrogen signaling pathway
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108388206 (TGFA)
   04012 ErbB signaling pathway
    108388206 (TGFA)
   04014 Ras signaling pathway
    108388206 (TGFA)
   04151 PI3K-Akt signaling pathway
    108388206 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108388206 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388206 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108388206 (TGFA)
   05212 Pancreatic cancer
    108388206 (TGFA)
   05225 Hepatocellular carcinoma
    108388206 (TGFA)
   05214 Glioma
    108388206 (TGFA)
   05211 Renal cell carcinoma
    108388206 (TGFA)
   05215 Prostate cancer
    108388206 (TGFA)
   05223 Non-small cell lung cancer
    108388206 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108388206 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 108388206
NCBI-ProteinID: XP_017502124
LinkDB
Position
Unknown
AA seq 138 aa
MVVTLMQLITDPPVAAAVVFHFNECPDSHSQFCFHGTCRFLVQEDKPACVCHSGYVGARC
EHADLLAVVAASQKKQAITALVVVSIVALAVLIIVCVLIHCCQVRKHCEWCQALICRHEK
PSALLKGRTSCCHSETVV
NT seq 417 nt   +upstreamnt  +downstreamnt
atggtggtgaccctgatgcagctaattaccgacccgcctgtggccgccgctgtggtgttc
cattttaatgaatgcccagattcccacagtcagttctgcttccatggaacctgcaggttt
ttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgtcggtgcacgctgt
gagcatgcagacctcctggcagtggtggccgccagccagaagaaacaggctatcaccgcc
ttggtggtggtctccatcgtggccctggctgtcctcatcattgtgtgtgtgctgatacac
tgctgccaggtccgaaaacactgtgagtggtgccaggccctcatctgccgacatgagaag
cccagtgccctcctgaagggaaggacttcttgctgccactcagaaacggtggtctga

DBGET integrated database retrieval system