KEGG   Manis javanica (Malayan pangolin): 108388480
Entry
108388480         CDS       T06054                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04115  p53 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04340  Hedgehog signaling pathway
mjv04371  Apelin signaling pathway
mjv04390  Hippo signaling pathway
mjv04510  Focal adhesion
mjv04530  Tight junction
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04934  Cushing syndrome
mjv05160  Hepatitis C
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05216  Thyroid cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108388480 (CCND1)
   04340 Hedgehog signaling pathway
    108388480 (CCND1)
   04390 Hippo signaling pathway
    108388480 (CCND1)
   04371 Apelin signaling pathway
    108388480 (CCND1)
   04630 JAK-STAT signaling pathway
    108388480 (CCND1)
   04068 FoxO signaling pathway
    108388480 (CCND1)
   04151 PI3K-Akt signaling pathway
    108388480 (CCND1)
   04152 AMPK signaling pathway
    108388480 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108388480 (CCND1)
   04115 p53 signaling pathway
    108388480 (CCND1)
   04218 Cellular senescence
    108388480 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108388480 (CCND1)
   04530 Tight junction
    108388480 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108388480 (CCND1)
   04921 Oxytocin signaling pathway
    108388480 (CCND1)
   04919 Thyroid hormone signaling pathway
    108388480 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108388480 (CCND1)
   05206 MicroRNAs in cancer
    108388480 (CCND1)
   05205 Proteoglycans in cancer
    108388480 (CCND1)
   05203 Viral carcinogenesis
    108388480 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108388480 (CCND1)
   05212 Pancreatic cancer
    108388480 (CCND1)
   05225 Hepatocellular carcinoma
    108388480 (CCND1)
   05226 Gastric cancer
    108388480 (CCND1)
   05214 Glioma
    108388480 (CCND1)
   05216 Thyroid cancer
    108388480 (CCND1)
   05221 Acute myeloid leukemia
    108388480 (CCND1)
   05220 Chronic myeloid leukemia
    108388480 (CCND1)
   05218 Melanoma
    108388480 (CCND1)
   05219 Bladder cancer
    108388480 (CCND1)
   05215 Prostate cancer
    108388480 (CCND1)
   05213 Endometrial cancer
    108388480 (CCND1)
   05224 Breast cancer
    108388480 (CCND1)
   05222 Small cell lung cancer
    108388480 (CCND1)
   05223 Non-small cell lung cancer
    108388480 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108388480 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108388480 (CCND1)
   04934 Cushing syndrome
    108388480 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108388480 (CCND1)
   05162 Measles
    108388480 (CCND1)
   05160 Hepatitis C
    108388480 (CCND1)
   05163 Human cytomegalovirus infection
    108388480 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108388480 (CCND1)
   05169 Epstein-Barr virus infection
    108388480 (CCND1)
   05165 Human papillomavirus infection
    108388480 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108388480 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108388480
NCBI-ProteinID: XP_017502464
LinkDB
Position
Unknown
AA seq 212 aa
MNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPDELLQME
LLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENRQIIRKHAQTFVALCATDVKFISNPPS
MVAAGSVVAAVQGLHLGSSSGLLSYHRLTRFLSKVIKCDPDCLRACQEQIEALLESSLRQ
AQQQHLDPKAADEEDEEAGLACTPTDVRDVNV
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactacctggaccgcttcctgtcgctggagcccgtgaagaagagccgcctgcagctg
ctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatcccgctgacggcc
gagaagttgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatggag
ctgctcctggtgaacaagctcaagtggaacctggctgccatgaccccgcacgacttcatc
gaacacttcctttccaaaatgcccgtagctgaggagaacagacagatcatccgcaaacac
gcgcagaccttcgttgccctctgcgccacagatgtgaagttcatttccaatccaccctcc
atggtggccgcagggagtgtggtggccgcagtgcaaggcttgcacctggggagctccagc
ggcctcctgtcctaccaccggctcacacggttcctctccaaagtgatcaagtgtgacccg
gactgcctgcgggcctgccaggagcagatcgaagccctgctggagtccagcctgcgccag
gcccagcagcagcacttggaccccaaggccgcggacgaggaggacgaggaggccggcctg
gcctgcacgcccaccgacgtgcgggacgtgaacgtttga

DBGET integrated database retrieval system