KEGG   Manis javanica (Malayan pangolin): 108389002
Entry
108389002         CDS       T06054                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108389002 (IL3RA)
   04151 PI3K-Akt signaling pathway
    108389002 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108389002 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108389002 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108389002 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389002 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108389002 (IL3RA)
   04090 CD molecules [BR:mjv04090]
    108389002 (IL3RA)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL3 receptor family
   108389002 (IL3RA)
CD molecules [BR:mjv04090]
 Proteins
  108389002 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 108389002
NCBI-ProteinID: XP_017503083
LinkDB
Position
Unknown
AA seq 486 aa
MAWLWLSVVLAPVSALLPTNQDPESPIKNLMMEPRNRTLTWDLNGNVSKIECALHSGYIT
KAKNNRYCQLYMVPSCEVTNYSVTVTMTTGQLFSTSILYPVQEGNPRAAAQHLTCWVHDV
DFLTCHWVVGPEAPDDVQYRLYVEDLETYAQWECPHYGEDLRGTHVRCYFDVTGLFKDFH
FLVKGASRGSNFHFLRLGLLFKDFHFLVKGASRGSSIPCSELYVDLMESERLRLPNITGR
CNKSLSIMEWKMTSHFNDRFVYKLQIEKGSDPPYTENLVSENSFVLYNPGIYTVRLQAKG
AFQNVWSEWSAPQHFASLWDQLPGFLAITLAGCTYLKTHVHFLGTPGSRPLRPPEPSLGP
FHRAFPVGLIPQLPTTTLGLPALLGFEELAIAQTLSHQDKSFMSEDALGRAWLAPSLLAL
GTLLALGLAFVICARYSVMRRLLPPIPRVKDPIGDSSQGDKMMVWEAGRDSQEDCAVAQV
QVVGET
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcctggctttggctgtccgtggttctggctccagtctccgctctgctgcccacgaat
caggatccagaatcaccgattaagaacttaatgatggagccaagaaatagaaccctgacc
tgggacctcaatggaaatgtttccaagatcgagtgtgccttacattcaggttacatcaca
aaggcaaagaacaaccgttactgccagctgtacatggttccctcctgtgaggtgacaaac
tacagtgtcactgtcactatgaccacaggtcagctgttctcaacgtcgattctgtatcct
gtgcaagaaggcaaccccagggcagccgcccaacacctgacctgctgggtccatgatgtg
gacttcctcacatgccactgggtggtggggccagaggcgccggatgacgtgcagtaccgc
ctctacgtggaggacctggagacgtatgcgcagtgggagtgcccacattatggagaagat
ctgaggggcacacacgtccgctgttatttcgatgtcaccgggctattcaaagatttccac
ttcctggtaaagggcgccagcaggggctccaatttccacttcctgaggctgggcctncta
ttcaaagatttccacttcctggtaaagggcgccagcaggggctccagcatcccctgctca
gaactctatgtggacttaatggaatctgagagactgaggctccccaacatcacaggaagg
tgtaataaatccctttctatcatggagtggaaaatgacaagtcacttcaatgacagattt
gtctataaacttcaaatagagaagggctcagaccctccctacacggagaacctggtctca
gaaaattcctttgtgctctacaaccccggaatctacacggtgaggctacaagccaaggga
gccttccagaacgtctggagtgagtggagcgccccccagcactttgcttccctctgggac
cagcttccaggctttctggccatcactctggcaggctgcacataccttaagacacacgtg
cattttctcgggacacctgggtcgaggcctctgaggccacctgaaccttccctcggcccc
tttcaccgtgccttccctgtgggactcattccccagctgcccaccaccaccctggggctg
cctgccctgcttggcttcgaggagctcgctattgcccaaactctcagtcaccaagataaa
tctttcatgtcggaggacgccctgggccgcgcctggctggccccgtcgctgctggcgctg
ggcacactgctggcgctggggctcgcgttcgtgatctgcgcgaggtactcggtgatgcgc
aggctcctcccgcccatcccccgcgtgaaggaccccatcggggacagctcccagggcgac
aagatgatggtctgggaggccggcagggacagccaggaggactgtgctgtggcccaggtg
caggtcgtgggggagacgtga

DBGET integrated database retrieval system