KEGG   Manis javanica (Malayan pangolin): 108389053
Entry
108389053         CDS       T06054                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04064  NF-kappa B signaling pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04390  Hippo signaling pathway
mjv04510  Focal adhesion
mjv04621  NOD-like receptor signaling pathway
mjv04668  TNF signaling pathway
mjv05132  Salmonella infection
mjv05145  Toxoplasmosis
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108389053 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108389053 (BIRC3)
   04064 NF-kappa B signaling pathway
    108389053 (BIRC3)
   04668 TNF signaling pathway
    108389053 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108389053 (BIRC3)
   04215 Apoptosis - multiple species
    108389053 (BIRC3)
   04217 Necroptosis
    108389053 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108389053 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108389053 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389053 (BIRC3)
   05202 Transcriptional misregulation in cancer
    108389053 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108389053 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108389053 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108389053 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108389053 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108389053 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108389053 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108389053 (BIRC3)
Peptidases and inhibitors [BR:mjv01002]
 Peptidase inhibitors
  Family I32: IAP family
   108389053 (BIRC3)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108389053 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 108389053
NCBI-ProteinID: XP_017503116
LinkDB
Position
Unknown
AA seq 604 aa
MNIVENSVFLSNLMKSTNLFELKYDFSCELYRMSTYSAFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDNPVEKHKKLYPSCSFVQNLSSVNILGATSQPTFPSSVTNS
THSLLPSLENSGYFSGSYSSFPSEPINSGPNQGFSALRTSPYHYTMNTEKARLLTFQMWP
LTFLSPADLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPKCPFLENQLQ
DTSRYTVSNLSMQTHGARFKTFCNWPSSVPVHPEQLASAGFYYMGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFISQIQASYPHLLEQLLSTSDNPEDENTESP
IIHFGPGENHSEDAVMMNTPVVKAALEMGFSRRLVKQTVQSKILTTGENYKTISDLVLDL
LNAEDEIREEEKERATEEKESDDLSLIRKNRMALFQQLTCVLPVLDSLLAAKVIDEQEHD
VIKEKTQTSLQARGLIDTILGKGNFAASIFKNSLQEIDPMLFKHLFVQQDIKYIPTEEVS
DLPVEEQLRRLQEERTCKVCMDQEVSVVFIPCGHLVVCKDCAPSLRKCPICRGTVKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaacagtgtattcttatcaaacttgatgaaaagtaccaatctgttt
gaactgaagtatgacttttcatgtgaactgtaccgaatgtctacatactcagctttccct
gcgggtgttcctgtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtg
aacgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaagcaaggagac
aatcctgttgaaaagcataaaaagctatatcctagttgtagctttgttcaaaatctaagt
tcagttaacattttgggagccacctctcagcctacttttccttcctcagtaacaaattcc
acacattcattacttccaagtttggaaaacagtggatatttcagtggctcttattcaagc
tttccatcagagcctataaactctggaccaaatcaagggttttctgccttgaggacaagt
ccctaccattacacaatgaatactgaaaaagccaggttacttacgttccagatgtggccg
ttgacctttctgtcaccagcagacttggcaaaagcgggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggatgat
gctatgtcagaacacctgagacatttccccaaatgcccatttttagaaaatcagcttcaa
gacacgtcaagatacaccgtctctaatctgagcatgcagacacatggagcccgttttaaa
acattctgtaactggccttccagtgttccagttcatcctgagcagcttgcaagtgcaggt
ttttattatatgggtcatagtgatgatgttaaatgcttttgttgcgatggtggactcagg
tgttgggaatctggagatgacccgtgggtggaacatgccaagtggtttccaaggtgtgag
tacttgatacgaattaaaggacaagagttcatcagtcaaattcaagccagttaccctcat
ctacttgaacagctgttatctacttcagataatccagaagatgaaaacacggagtcacca
attattcattttggacctggagaaaaccattcagaagatgcagtcatgatgaatacacct
gtggttaaagctgccttggaaatgggctttagtagaaggctggtaaaacagacagttcag
agtaaaatcctaacaactggagagaattataaaaccatcagtgatcttgtattagattta
cttaatgcagaagatgaaataagggaggaggagaaagaaagagcaactgaggaaaaagaa
tcagatgatctatcactaatccggaagaacagaatggcactttttcaacagttgacttgt
gtgcttccagtcctggatagtctgctagctgccaaagtaattgatgaacaagaacatgat
gttattaaagagaaaactcagacatctttacaagcaagaggactgattgatactatatta
ggaaaaggaaattttgcagccagcatattcaaaaactctttacaagaaattgaccccatg
ttatttaagcatttatttgtgcaacaggacataaagtatattcccacagaagaggtttca
gacttaccagtggaagaacaattgaggagactacaagaggaaagaacatgtaaagtgtgc
atggaccaagaagtatccgtggtgttcattccttgtggccatctagtagtatgcaaagat
tgtgctccttctctaagaaaatgccctatttgtagaggtacagttaagggtacagttcgc
acatttctttcatga

KEGG   Manis javanica (Malayan pangolin): 108389075
Entry
108389075         CDS       T06054                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04064  NF-kappa B signaling pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04390  Hippo signaling pathway
mjv04510  Focal adhesion
mjv04621  NOD-like receptor signaling pathway
mjv04668  TNF signaling pathway
mjv05132  Salmonella infection
mjv05145  Toxoplasmosis
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108389075 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108389075 (BIRC2)
   04064 NF-kappa B signaling pathway
    108389075 (BIRC2)
   04668 TNF signaling pathway
    108389075 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108389075 (BIRC2)
   04215 Apoptosis - multiple species
    108389075 (BIRC2)
   04217 Necroptosis
    108389075 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108389075 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108389075 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108389075 (BIRC2)
   05202 Transcriptional misregulation in cancer
    108389075 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108389075 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108389075 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108389075 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108389075 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108389075 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108389075 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108389075 (BIRC2)
Peptidases and inhibitors [BR:mjv01002]
 Peptidase inhibitors
  Family I32: IAP family
   108389075 (BIRC2)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108389075 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 NikR_C zf-RING_UBOX
Other DBs
NCBI-GeneID: 108389075
NCBI-ProteinID: XP_017503144
LinkDB
Position
Unknown
AA seq 597 aa
MDDRAILSNWTVGSKQKMKYDFSCELYRMSTYSAFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPVEKHKQLYPSCSFIQNLVSVASLESASNNTSPMRSSFTHCLS
PSLGLSSSFSDSYSNLSPNPVNSRAVEDFSPLRTNPYSYAMSTEEARFLTYHMWPLTFLS
PLELARAGFYYLGPGDRVACFACGGTLSNWEPKDDAMSEHRRHFPSCPFLENSVEMLRFS
ISNLSMQTHAARLRTFVCWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD
DPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDAPGDENVDPPIYFGPG
ESSSEDAVMMNTPVVKAALEMGFSRSLVKQTVQRKILTTGENYKTVNDVVSALLNAEIEK
REEEKERQTEEIASDDLSLIRRNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQ
IPLQARELIDTILVKGNAAANIFKTCLKEIDSALYENLFVEKNMKYIPTEDVSGLSLEEQ
LRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggatgatagggcgatcttatcaaattggacagttggcagcaaacaaaaaatgaaatat
gatttttcatgtgaactgtaccgaatgtctacatactcagctttccctgcgggtgttcct
gtctcagagaggagtcttgctcgtgctggtttttattacactggtgtgaatgacaaggtc
aaatgtttctgttgtggcctgatgctggataactggaagcaaggagacaatcctgttgaa
aaacataaacagctgtatcctagctgtagctttattcagaatctggtttctgttgctagt
ctggaatctgcctctaacaatacttctccaatgagaagcagttttacacattgtttgtct
cccagtttgggacttagtagctcattcagtgattcgtattccaacctttcaccaaaccct
gttaattctagagcagttgaagacttctccccattgaggactaacccttacagttatgca
atgagtaccgaagaagccagatttcttacttatcatatgtggccattaaccttcttgtca
ccattagaattggcaagagctggcttttattacttaggacccggagatagggtggcctgc
tttgcctgtggtgggacactaagtaactgggagccgaaggatgatgccatgtcagaacat
cggagacatttccccagttgtccatttttggaaaattctgtggaaatgctgaggtttagc
atttcaaatttgagcatgcagacgcatgcagcaagactgagaacattcgtgtgctggccc
tccagtgtaccagttcagcctgagcagcttgcaagtgccggtttctattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaatctggagat
gacccatgggtagaacatgccaagtggtttccaagatgtgagttcttgatacgcatgaaa
gggcaagaatttgttgatgagattcaagctagatatcctcacctccttgaacagctcttg
tcaacttctgatgctcctggagatgaaaatgttgatccaccaatttattttggacctgga
gaaagttcttccgaagatgcagtcatgatgaatacgcctgtggttaaagctgccttagaa
atgggcttcagtagaagcttggtaaaacagacagttcagcgtaaaatcctaacaactgga
gagaattacaaaacagttaatgatgttgtgtcagcacttcttaatgctgaaattgaaaaa
agagaagaggagaaggaaagacaaactgaagaaatcgcatcagatgatttgtcattaatt
cggaggaatagaatggctctctttcagcagttgacgtgtgtgcttcctatcctggataat
cttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaacacag
atacctttacaagcaagagaactaattgataccattttagttaaaggaaatgctgctgcc
aacatcttcaaaacttgtctaaaagaaattgactctgcattatatgagaatttatttgtg
gaaaagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaacag
ttgaggagactgcaagaagaacgaacttgtaaagtgtgtatggacaaagaggtttccgtg
gtgttcattccttgtggccatctggtagtatgccaagaatgtgccccttctctaagaaaa
tgtcctatttgcaggggtataattaagggtactgttcgtacatttctctcgtaa

KEGG   Manis javanica (Malayan pangolin): 108391115
Entry
108391115         CDS       T06054                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP isoform X1
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04064  NF-kappa B signaling pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04510  Focal adhesion
mjv04621  NOD-like receptor signaling pathway
mjv05145  Toxoplasmosis
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108391115 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108391115 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108391115 (XIAP)
   04215 Apoptosis - multiple species
    108391115 (XIAP)
   04217 Necroptosis
    108391115 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108391115 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108391115 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108391115 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108391115 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108391115 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108391115 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108391115 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108391115 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108391115 (XIAP)
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108391115 (XIAP)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108391115 (XIAP)
Peptidases and inhibitors [BR:mjv01002]
 Peptidase inhibitors
  Family I32: IAP family
   108391115 (XIAP)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108391115 (XIAP)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    108391115 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 108391115
NCBI-ProteinID: XP_017506025
LinkDB
Position
Unknown
AA seq 529 aa
MLVAGTELCGVCLARACEAERTGEKVDKSYVQEKMTFNSFEGSKTYVPADIKKDEEYVEE
FNRLKTFANFPSTSPVAPSTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKV
SPNCRFINGFYFENNPAQSTNHVQNGQDSAENSLANRNLFVLDRPSETHADYLLRTGQVV
DISDTIYPRNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIDDQVECFCCGGKL
KNWEPCDRAWSEHRRHFPNCFFVLGRNVNIQSECDVVSSDRNFSNSTNVRNPAMANYEAR
IITFGTWIYPVNKEQLARAGFYALAEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCK
YLLEEKGQEYINNIHLTHSLEESMARTAEKTPSLTKRIDDTIFQNPMVQEAIRMGFSFRD
IKKIMEEKIQTCGSNYKSLEILVADLVSAQKDNIQDESSQTSLQKEISAEEQLRLLQEEK
MCKICMDRSIAIVFIPCGHLVTCKQCAEAVNKCPMCYTVITFKQKIFMS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcttgtggcaggtacggagctgtgtggagtgtgtctggcgagggcgtgcgaagccgaa
agaactggagaaaaggtggacaagtcctatgttcaagagaagatgacttttaacagtttt
gaaggatctaaaacttatgtacctgcagacatcaagaaggatgaagaatatgtagaagag
tttaacagattaaaaacttttgctaattttccaagtactagtcctgttgcaccatcaaca
ctagcccgagctggttttctgtacactggtgaaggggacactgtgcggtgctttagctgt
catgccgcagtagataggtggcagtatggagactcagcagttggaagacacaggaaagta
tctccaaattgcagatttatcaatggcttttatttcgaaaataatcctgcacagtctaca
aatcatgtccaaaatggtcaggacagcgctgaaaactctctggcaaacagaaatcttttt
gttttagataggccatctgagactcatgcagactatcttttgagaactgggcaggttgta
gatatatcagacaccatatacccaaggaaccctgccatgtgcagtgaagaagctagatta
aagtcatttcaaaactggccagactatgcgcacttaactccaagggagttggctagtgct
ggactctactacacgggtattgatgatcaggtggagtgcttttgttgtggtggaaaactg
aaaaattgggagccttgtgatcgtgcatggtcagagcacaggcgacactttcccaattgt
ttctttgttttgggccggaatgttaatattcaaagtgaatgtgatgttgtgagttctgat
aggaatttctcaaattcaacaaatgtacgaaacccagccatggcaaattatgaagcacgg
atcattacttttgggacatggatatacccagttaacaaggagcagcttgcaagagctgga
ttttatgctttagctgaaggtgataaagtaaagtgctttcactgtggaggagggctaact
gattggaagcccagtgaagacccttgggaacaacatgctaagtggtatccagggtgtaaa
tatctgttagaagagaagggacaagaatatataaacaatattcatttaacccattctctt
gaggagtctatggcaagaactgctgaaaaaacaccatcactaactaaaagaattgatgat
accattttccaaaatcctatggtacaagaagctatacgaatgggattcagtttcagggac
attaagaaaataatggaggaaaaaattcagacatgtgggagcaactataaatcacttgaa
attctagttgcagatctagtgagtgctcagaaagacaatatacaagatgaatcaagtcag
acttcattgcagaaagagatcagtgctgaagagcagctaaggctcctacaagaggagaag
atgtgcaaaatctgtatggacagaagtattgctatagtttttattccttgtggacatctg
gtcacttgtaaacagtgtgctgaagcagttaacaaatgtcccatgtgctacacagtcatt
acttttaagcaaaaaatttttatgtcttaa

KEGG   Manis javanica (Malayan pangolin): 108407801
Entry
108407801         CDS       T06054                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04390  Hippo signaling pathway
mjv05161  Hepatitis B
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108407801 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108407801 (BIRC5)
   04215 Apoptosis - multiple species
    108407801 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108407801 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108407801 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108407801 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108407801 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108407801 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mjv03036]
    108407801 (BIRC5)
Peptidases and inhibitors [BR:mjv01002]
 Peptidase inhibitors
  Family I32: IAP family
   108407801 (BIRC5)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     108407801 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108407801 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 108407801
NCBI-ProteinID: XP_017532889
LinkDB
Position
Unknown
AA seq 142 aa
MGAASLPSAWQLYLKDHRISTFKNWPFLEGCACTPERMAAAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPVEEHKKHSSGCGFLSVKKHFEELTLSEFLKLDKERAKNKIAMETSNK
QKEFEETAKSVRCAIEQLAAQD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgctgcgtctttgccctcggcctggcagctctacctcaaggaccatcgtatctct
acgttcaagaactggcccttcttggaaggctgcgcgtgcactccggagcggatggccgca
gccggcttcatccactgccccacggagaacgagcccgacttggctcagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccgtagaggaacataaaaagcat
tcttctggttgtggttttctttctgtcaagaagcattttgaagaattaaccctcagtgaa
tttttgaaactggacaaagaaagagccaagaacaagattgcaatggaaaccagcaataag
cagaaagaatttgaagaaactgcaaagagcgtgcgctgtgccatagagcagctggctgcc
caggactga

DBGET integrated database retrieval system