KEGG   Manis javanica (Malayan pangolin): 108390012
Entry
108390012         CDS       T06054                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04530  Tight junction
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05215  Prostate cancer
mjv05219  Bladder cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108390012 (ERBB2)
   04012 ErbB signaling pathway
    108390012 (ERBB2)
   04066 HIF-1 signaling pathway
    108390012 (ERBB2)
   04020 Calcium signaling pathway
    108390012 (ERBB2)
   04151 PI3K-Akt signaling pathway
    108390012 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108390012 (ERBB2)
   04520 Adherens junction
    108390012 (ERBB2)
   04530 Tight junction
    108390012 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390012 (ERBB2)
   05206 MicroRNAs in cancer
    108390012 (ERBB2)
   05205 Proteoglycans in cancer
    108390012 (ERBB2)
   05230 Central carbon metabolism in cancer
    108390012 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108390012 (ERBB2)
   05226 Gastric cancer
    108390012 (ERBB2)
   05219 Bladder cancer
    108390012 (ERBB2)
   05215 Prostate cancer
    108390012 (ERBB2)
   05213 Endometrial cancer
    108390012 (ERBB2)
   05224 Breast cancer
    108390012 (ERBB2)
   05223 Non-small cell lung cancer
    108390012 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108390012 (ERBB2)
   01524 Platinum drug resistance
    108390012 (ERBB2)
   01522 Endocrine resistance
    108390012 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108390012 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108390012 (ERBB2)
   04090 CD molecules [BR:mjv04090]
    108390012 (ERBB2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108390012 (ERBB2)
Protein kinases [BR:mjv01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   108390012 (ERBB2)
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   108390012 (ERBB2)
CD molecules [BR:mjv04090]
 Proteins
  108390012 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like RIFIN PIRT
Other DBs
NCBI-GeneID: 108390012
NCBI-ProteinID: XP_017504077
LinkDB
Position
Unknown
AA seq 1261 aa
MELAAWYRWGLLLALLPPGAAGTQVCTGTDMKLQLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPASASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIIRGTHLFEDNYALAVLDNG
DLLDSATPATGAAPGGLRELQLRSLTEILKGGVLIQRNLQLCHQDTVLWKDIFHKNNQLA
LTLIDTNSSRTCQPCSPACKTSHCWGESSEDCQSLTRTVCASGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTTCP
YNYLSTDVGSCTLVCPVNNQEVTSEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFKGDPASSTAPLQPEQLRVFETLEEITGYLYISAWPDSLS
NLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLHSLRELGSGLALIHRNAHLCFVHTV
PWDQLFRNPHQALLHSANRPEDECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLKGLPREYVKDRNCLPCHPECQPQNGSVTCFGSEANQCVACAHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGMCQPCPTNCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLFVVIGLVLVLLIKRKRQKNRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPSSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAAGAGGTAHRRHRSSSTRSGGGELTLGLEHSEEEEPPKSPLTPSE
GAGSDVFDGDLGMGTAKGLQSLPQHDPSSLQRYSEDPTVLLLPETDGYVAPLTCSPQPEY
VNQPEVRPQPPSPLEGPLSPCRPAGATLERPKTLSPKTLSHGKNGVVKDIFAFGSAVENP
EYLAPRGRAAPQPHTLPAFSPAFDNLYYWDQDPSDRGSPPSTFEGTPTVENPEYLGLDAP
V
NT seq 3786 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtaccgctgggggctcctccttgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcagctcccagccagtcccgag
acccacctggacatgctccgccacctctaccagggttgtcaggtggtacagggtaacctg
gagctcacctacctgcctgccagtgccagcctctccttcctgcaggatatccaggaggtc
cagggctatgtgctcatcgcccacaaccaagtgagacaggtcccgctgcagaggctgcga
atcatacgaggcacccatctctttgaggacaactatgccctggccgtgcttgacaatgga
gacctgctagatagtgccacccccgctacaggggctgccccggggggactgcgggagctg
cagctgcgaagcctcacagagatcttgaagggaggggtcttgatccagcggaaccttcag
ctctgccaccaggacaccgttttgtggaaggacatcttccacaagaacaaccagctggcc
ctcacgctgatagacaccaacagctcacggacctgccaaccctgttctccagcttgtaag
acctcccactgctggggagagagttccgaggactgtcagagcttgacgcgaactgtctgt
gccagtggctgtgcccgctgcaagggcccgctgcccacagactgttgccatgagcaatgt
gctgctggctgcacgggccccaaacactccgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacgtttgag
tccatgcctaaccctgagggccgttacaccttcggcgccagctgtgtgaccacctgtccc
tacaactacctgtctacggatgtggggtcctgcaccctggtctgccctgtgaacaaccaa
gaggtgacatctgaggatggaacacagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcagtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttcttccagagagc
tttaagggggacccagcctccagcacggctcccctgcagcctgagcagctcagagtgttt
gagactctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgtct
aacctcagtgtcttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcactgaccctgcaagggctaggcatcagctggctggggctgcactccctgcgagaa
ctgggcagtggcctggccctcatccaccgcaatgcccacctctgcttcgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggatgagtgtgtgggtgagggcctggcctgctacccactgtgcgcccacgggcactgc
tggggtccggggcccacccagtgtgtcaactgcagccagttccttcgtggccaggagtgc
gtggaggaatgccgagtactgaaggggcttccccgggagtacgtgaaggacaggaactgt
ctgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgctttggatcggag
gccaaccagtgtgtggcctgcgcccactacaaggaccctcccttctgtgttgctcgctgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcatgtgccagccatgccccaccaactgcacccactcctgtgtggacctggatgacaag
ggttgccctgctgagcagagagccagccctgtgacatccatcattgctgctgtggtgggc
attctgctgttcgtggtcatagggctggtcctggtcctcctaattaagcgaaagcggcag
aagaaccgcaagtacacgatgcggcggctgctgcaggaaactgagctggtggagccgctg
actcctagtggagcaatgcctaaccaggctcagatgcggatcctgaaagagacagagctg
aggaaagtgaaggtgcttggatccggagcttttggcacagtctacaagggcatctggatc
cctgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggatgaagcatatgtgatggctggcgtgggctcccca
tatgtgtcccgcctcctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccacgtccgagaacaccgcgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggaggaagtgcgg
cttgtgcacagggacctggctgcccggaacgtgctggttaagagtcccaaccatgtcaag
attacagactttgggctagcacggctgctggatattgatgagacggagtaccacgcagat
gggggcaaggtgcccatcaagtggatggcattggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttatgatgggatcccagcccgagagatccctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
atcgactccgaatgtcggccaaggttccgggagctggtggccgagttctcgcgcatggcc
agggacccccagcgttttgttgtcatccagaatgaggacttgggcccttccagccccttg
gacagcacattctaccgctcgctgctggaggatgatgacatgggggacctggtagatgct
gaggagtacctagttccccagcagggcttcttctgcccagaccctgcggccggcgctggg
ggcacggcccaccgcaggcaccgtagctcatccaccaggagtggcggtggtgagctaacg
ctggggctggagcactccgaggaggaggagccccccaagtccccactgacaccctcagaa
ggggctggctctgatgtgtttgatggcgacttgggaatggggacagccaaggggctgcag
agcctcccccaacatgaccccagctctctacagcgttacagcgaggaccccacagtactc
ctgctccctgagactgatggctacgttgcccccctcacctgcagcccccagcctgaatat
gtgaaccagccagaagttcggccacaacccccctcacccctagagggccctctgtctcct
tgtcgacctgctggtgccactctggaaaggcccaagactctttccccaaaaaccctctcc
catggaaagaatggggttgtcaaagacatttttgcctttgggagtgccgtggagaaccct
gagtacttggcaccccggggcagggctgcccctcagccccacactctaccagccttcagc
ccagcctttgacaacctctattactgggaccaggacccatcagatcggggctctccaccc
agcacctttgaagggacccctacggtggagaatcctgagtacctgggcctggatgcgcca
gtgtga

DBGET integrated database retrieval system