KEGG   Manis javanica (Malayan pangolin): 108390063
Entry
108390063         CDS       T06054                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04630  JAK-STAT signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04664  Fc epsilon RI signaling pathway
mjv05200  Pathways in cancer
mjv05310  Asthma
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390063 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390063 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108390063 (IL13)
   04657 IL-17 signaling pathway
    108390063 (IL13)
   04664 Fc epsilon RI signaling pathway
    108390063 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390063 (IL13)
  09163 Immune disease
   05310 Asthma
    108390063 (IL13)
   05321 Inflammatory bowel disease
    108390063 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108390063 (IL13)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108390063 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 108390063
NCBI-ProteinID: XP_017504170
LinkDB
Position
Unknown
AA seq 130 aa
MALWLTVVIALTCLGGLATPGPVPHSRALKELIEELVNITRNQASLCNGSMVWEVNMTAG
KYCAALDSLTNVSDCSAIGKTQRLLKLLCPVKASPVDSSEPIRDTKVEVTQLIKDLLKHL
REIFRHGELN
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcactctggttgaccgtggtcattgccctcacctgccttggtggcctcgccaccccg
ggccccgtgcctcactccagagccctcaaggagctcattgaggagctagtcaacatcacc
aggaaccaggcatccctctgcaacggcagcatggtgtgggaagttaacatgacagccggc
aagtactgtgcagccctggactccctgaccaacgtctctgactgcagtgccatcggaaag
acccagaggctattgaaattactctgccctgtcaaggcctcacctgtggattccagtgag
cctatccgagacaccaaagttgaagtgacccagctgataaaagacctgctcaagcattta
agggaaatctttcgccatggagaactcaactga

DBGET integrated database retrieval system