KEGG   Manis javanica (Malayan pangolin): 108390065
Entry
108390065         CDS       T06054                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04672  Intestinal immune network for IgA production
mjv05140  Leishmaniasis
mjv05200  Pathways in cancer
mjv05310  Asthma
mjv05320  Autoimmune thyroid disease
mjv05321  Inflammatory bowel disease
mjv05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108390065 (IL4)
   04151 PI3K-Akt signaling pathway
    108390065 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108390065 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108390065 (IL4)
   04660 T cell receptor signaling pathway
    108390065 (IL4)
   04658 Th1 and Th2 cell differentiation
    108390065 (IL4)
   04659 Th17 cell differentiation
    108390065 (IL4)
   04657 IL-17 signaling pathway
    108390065 (IL4)
   04664 Fc epsilon RI signaling pathway
    108390065 (IL4)
   04672 Intestinal immune network for IgA production
    108390065 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390065 (IL4)
  09163 Immune disease
   05310 Asthma
    108390065 (IL4)
   05320 Autoimmune thyroid disease
    108390065 (IL4)
   05321 Inflammatory bowel disease
    108390065 (IL4)
   05330 Allograft rejection
    108390065 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108390065 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108390065 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108390065 (IL4)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108390065 (IL4)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Haparin
  Cytokines
   108390065 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 108390065
NCBI-ProteinID: XP_017504172
LinkDB
Position
Unknown
AA seq 134 aa
MGLTSQLIPTLVCFLAFTSNFIHGHKRGVALLEIIRTLNILTARNDPCMELTIQDTFAAP
KNTTEKETFCRAANALRQFYKEHKCWRRLLSGLDRNLSSTANTTFCPMKEAKKSTLKDFL
ERLKMNMKRKYSKY
NT seq 405 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaaccctggtctgctttctagcattcaccagcaac
ttcatccacggacacaagaggggtgttgccttactggagatcatcagaacgctgaacatc
ctcacagcgagaaacgatccatgcatggagctgactatacaggacaccttcgctgcccca
aagaacacaactgagaaggaaaccttctgcagggctgcaaatgcgcttcggcagttctat
aaagagcacaagtgctggcgcagacttttgagcggacttgacaggaacctcagcagcacg
gcaaacacgaccttctgtcctatgaaggaggccaagaagagcacattgaaagacttcctg
gaaaggctaaagatgaacatgaaaaggaaatactcaaagtattga

DBGET integrated database retrieval system