KEGG   Manis javanica (Malayan pangolin): 108390201Help
Entry
108390201         CDS       T06054                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04218  Cellular senescence
mjv04670  Leukocyte transendothelial migration
mjv05200  Pathways in cancer
mjv05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108390201 (RASSF5)
   04015 Rap1 signaling pathway
    108390201 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108390201 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108390201 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390201 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    108390201 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA
Motif
Other DBs
NCBI-GeneID: 108390201
NCBI-ProteinID: XP_017504430
LinkDB All DBs
Position
Unknown
AA seq 279 aa AA seqDB search
MEVCVVGGQLLSLDCKFTCHPECRSLIQLDCSQQGGASRDRPSPESTLTPISSQNVCKPA
EETPHLPTLQEIKQKIDSYNTREKYCLGMKLSEDGSYTGFIKVHLKLRRPVTVPAGIRPQ
SIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFA
LFKRMHKDGQVLFQKLSIADRPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQN
FLTILEKEEQDKIQQVQKKYDKFRQKLEAALRESQGKPG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctgcgttgtgggtggacagctgctgtcacttgactgcaaattcacctgccac
ccggagtgccgcagcctgatccagctggactgcagtcagcaggggggcgcgtccagggac
cggccctctccggagagcaccctcacgcccatctccagccagaatgtctgcaaacccgca
gaggagactccgcacctgcccacactgcaggagatcaagcagaagattgacagctacaac
acgcgggagaagtactgcctgggcatgaagctgagcgaagacggttcctacacgggtttc
atcaaagtgcatttgaaacttcggcggccagtgacggtgcccgctgggatccggccccag
tccatctatgatgccatcaaggaagttaacctggcagccaccacggacaagcggacatct
ttctacctgccgctcgatgccatcaagcagctacacattagcagcaccaccacggtcagc
gaagtgatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgca
ctgtttaagcggatgcacaaggatgggcaagtcctcttccagaagctctccatcgccgac
cgccccctctacctgcgcctgctggctgggcctgacaccgatgtcctcagctttgtgctc
aaggagaatgaaactggagaggtggagtgggatgccttctccatccccgagctccagaac
ttcctaacaatcctggaaaaagaggagcaggacaaaatccagcaagtgcagaagaagtat
gacaagttcaggcagaaactggaggcggccttaagagaatcccagggcaaacctggctga

DBGET integrated database retrieval system