KEGG   Manis javanica (Malayan pangolin): 108390232
Entry
108390232         CDS       T06054                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108390232 (PMAIP1)
   04215 Apoptosis - multiple species
    108390232 (PMAIP1)
   04115 p53 signaling pathway
    108390232 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390232 (PMAIP1)
   05203 Viral carcinogenesis
    108390232 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108390232 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108390232 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 108390232
NCBI-ProteinID: XP_017504477
LinkDB
Position
Unknown
AA seq 54 aa
MPGKKARKNAQPSPSRAPAELAVECAIQLRRIGDKLNFRQKLLNLISKLFRLGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgtaagaacgcgcagccgagcccttcgcgggccccggcagag
cttgcagttgagtgtgccattcagctcagaaggattggagacaaactgaatttccggcag
aaacttctgaatctgatatccaaactcttccgcttgggaacctga

DBGET integrated database retrieval system