KEGG   Manis javanica (Malayan pangolin): 108390484
Entry
108390484         CDS       T06054                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04371  Apelin signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04725  Cholinergic synapse
mjv04728  Dopaminergic synapse
mjv04910  Insulin signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04922  Glucagon signaling pathway
mjv04923  Regulation of lipolysis in adipocytes
mjv04926  Relaxin signaling pathway
mjv04929  GnRH secretion
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv04973  Carbohydrate digestion and absorption
mjv05010  Alzheimer disease
mjv05017  Spinocerebellar ataxia
mjv05132  Salmonella infection
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108390484 (AKT2)
   04012 ErbB signaling pathway
    108390484 (AKT2)
   04014 Ras signaling pathway
    108390484 (AKT2)
   04015 Rap1 signaling pathway
    108390484 (AKT2)
   04370 VEGF signaling pathway
    108390484 (AKT2)
   04371 Apelin signaling pathway
    108390484 (AKT2)
   04630 JAK-STAT signaling pathway
    108390484 (AKT2)
   04668 TNF signaling pathway
    108390484 (AKT2)
   04066 HIF-1 signaling pathway
    108390484 (AKT2)
   04068 FoxO signaling pathway
    108390484 (AKT2)
   04072 Phospholipase D signaling pathway
    108390484 (AKT2)
   04071 Sphingolipid signaling pathway
    108390484 (AKT2)
   04024 cAMP signaling pathway
    108390484 (AKT2)
   04022 cGMP-PKG signaling pathway
    108390484 (AKT2)
   04151 PI3K-Akt signaling pathway
    108390484 (AKT2)
   04152 AMPK signaling pathway
    108390484 (AKT2)
   04150 mTOR signaling pathway
    108390484 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108390484 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    108390484 (AKT2)
   04218 Cellular senescence
    108390484 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108390484 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    108390484 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108390484 (AKT2)
   04613 Neutrophil extracellular trap formation
    108390484 (AKT2)
   04620 Toll-like receptor signaling pathway
    108390484 (AKT2)
   04625 C-type lectin receptor signaling pathway
    108390484 (AKT2)
   04660 T cell receptor signaling pathway
    108390484 (AKT2)
   04662 B cell receptor signaling pathway
    108390484 (AKT2)
   04664 Fc epsilon RI signaling pathway
    108390484 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    108390484 (AKT2)
   04062 Chemokine signaling pathway
    108390484 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108390484 (AKT2)
   04922 Glucagon signaling pathway
    108390484 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    108390484 (AKT2)
   04920 Adipocytokine signaling pathway
    108390484 (AKT2)
   04929 GnRH secretion
    108390484 (AKT2)
   04915 Estrogen signaling pathway
    108390484 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    108390484 (AKT2)
   04917 Prolactin signaling pathway
    108390484 (AKT2)
   04926 Relaxin signaling pathway
    108390484 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    108390484 (AKT2)
   04919 Thyroid hormone signaling pathway
    108390484 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108390484 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108390484 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    108390484 (AKT2)
   04728 Dopaminergic synapse
    108390484 (AKT2)
   04722 Neurotrophin signaling pathway
    108390484 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108390484 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    108390484 (AKT2)
   04213 Longevity regulating pathway - multiple species
    108390484 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390484 (AKT2)
   05205 Proteoglycans in cancer
    108390484 (AKT2)
   05230 Central carbon metabolism in cancer
    108390484 (AKT2)
   05231 Choline metabolism in cancer
    108390484 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108390484 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108390484 (AKT2)
   05212 Pancreatic cancer
    108390484 (AKT2)
   05225 Hepatocellular carcinoma
    108390484 (AKT2)
   05226 Gastric cancer
    108390484 (AKT2)
   05214 Glioma
    108390484 (AKT2)
   05221 Acute myeloid leukemia
    108390484 (AKT2)
   05220 Chronic myeloid leukemia
    108390484 (AKT2)
   05218 Melanoma
    108390484 (AKT2)
   05211 Renal cell carcinoma
    108390484 (AKT2)
   05215 Prostate cancer
    108390484 (AKT2)
   05213 Endometrial cancer
    108390484 (AKT2)
   05224 Breast cancer
    108390484 (AKT2)
   05222 Small cell lung cancer
    108390484 (AKT2)
   05223 Non-small cell lung cancer
    108390484 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108390484 (AKT2)
   05017 Spinocerebellar ataxia
    108390484 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108390484 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108390484 (AKT2)
   04931 Insulin resistance
    108390484 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108390484 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108390484 (AKT2)
   05135 Yersinia infection
    108390484 (AKT2)
   05152 Tuberculosis
    108390484 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108390484 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    108390484 (AKT2)
   05161 Hepatitis B
    108390484 (AKT2)
   05160 Hepatitis C
    108390484 (AKT2)
   05164 Influenza A
    108390484 (AKT2)
   05162 Measles
    108390484 (AKT2)
   05168 Herpes simplex virus 1 infection
    108390484 (AKT2)
   05163 Human cytomegalovirus infection
    108390484 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108390484 (AKT2)
   05169 Epstein-Barr virus infection
    108390484 (AKT2)
   05165 Human papillomavirus infection
    108390484 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108390484 (AKT2)
   05142 Chagas disease
    108390484 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108390484 (AKT2)
   01524 Platinum drug resistance
    108390484 (AKT2)
   01522 Endocrine resistance
    108390484 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108390484 (AKT2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108390484 (AKT2)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   108390484 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Pkinase_fungal Peptidase_C39 Seadorna_VP7
Other DBs
NCBI-GeneID: 108390484
NCBI-ProteinID: XP_017505010
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRVPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGHYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRYPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSKDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPGDAREVMEHRFFLGINWQDVMQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctacataagcgcggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagtgatggctccttcattggctacaaggag
cggcccgaagcccctgaccagaccctgccccctctcaacaacttctccgttgcagaatgc
cagctgatgaagaccgaaagaccacggcccaacacctttgtcattcgctgcctacagtgg
actaccgtcattgagaggaccttccatgtcgactctccagatgagagggaggagtggatg
cgggccatccagatggtcgctaacagcctcaagcagcgggttccaggtgaggaccccatg
gactacaagtgtggctcccccagcgactcttctgcagccgaggagatggaggtggcagtc
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaaactcttgggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccaccggccactactatgccatg
aagatcctgcggaaggaagttatcattgccaaggatgaagttgcccacacagtcactgag
agccgggtcctccagaacaccagatatcccttcctcacggcgctgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtatgccaacggcggtgagctcttcttccac
ctgtcccgggagcgggtcttcacggaagagcgggcccgcttttatggcgcagagattgtc
tccgccctcgagtacttgcactcgaaggatgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctatgcaaagagggc
atcagtgatggggccaccatgaaaaccttctgtgggacccccgagtatctggcacccgag
gtgctggaggacaacgactatggtcgcgctgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagattcgcttcccacgcacgctcagccctgaggccaagtccctg
ctcgccgggctgcttaagaaggaccctaagcagaggcttggcggggggcccggtgatgcc
agggaggtcatggagcacaggttcttcctcggcatcaactggcaggatgtgatgcagaag
aagctcctgccacccttcaaacctcaggtcacatccgaggtcgacacaaggtactttgac
gatgagttcacggcccagtccatcacgatcacacccccggaccgctatgacagcctgggc
tcactcgaactggaccagaggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Manis javanica (Malayan pangolin): 108393746
Entry
108393746         CDS       T06054                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04371  Apelin signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04725  Cholinergic synapse
mjv04728  Dopaminergic synapse
mjv04910  Insulin signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04922  Glucagon signaling pathway
mjv04923  Regulation of lipolysis in adipocytes
mjv04926  Relaxin signaling pathway
mjv04929  GnRH secretion
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv04973  Carbohydrate digestion and absorption
mjv05010  Alzheimer disease
mjv05017  Spinocerebellar ataxia
mjv05132  Salmonella infection
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108393746 (AKT3)
   04012 ErbB signaling pathway
    108393746 (AKT3)
   04014 Ras signaling pathway
    108393746 (AKT3)
   04015 Rap1 signaling pathway
    108393746 (AKT3)
   04370 VEGF signaling pathway
    108393746 (AKT3)
   04371 Apelin signaling pathway
    108393746 (AKT3)
   04630 JAK-STAT signaling pathway
    108393746 (AKT3)
   04668 TNF signaling pathway
    108393746 (AKT3)
   04066 HIF-1 signaling pathway
    108393746 (AKT3)
   04068 FoxO signaling pathway
    108393746 (AKT3)
   04072 Phospholipase D signaling pathway
    108393746 (AKT3)
   04071 Sphingolipid signaling pathway
    108393746 (AKT3)
   04024 cAMP signaling pathway
    108393746 (AKT3)
   04022 cGMP-PKG signaling pathway
    108393746 (AKT3)
   04151 PI3K-Akt signaling pathway
    108393746 (AKT3)
   04152 AMPK signaling pathway
    108393746 (AKT3)
   04150 mTOR signaling pathway
    108393746 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108393746 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    108393746 (AKT3)
   04218 Cellular senescence
    108393746 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108393746 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    108393746 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108393746 (AKT3)
   04613 Neutrophil extracellular trap formation
    108393746 (AKT3)
   04620 Toll-like receptor signaling pathway
    108393746 (AKT3)
   04625 C-type lectin receptor signaling pathway
    108393746 (AKT3)
   04660 T cell receptor signaling pathway
    108393746 (AKT3)
   04662 B cell receptor signaling pathway
    108393746 (AKT3)
   04664 Fc epsilon RI signaling pathway
    108393746 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    108393746 (AKT3)
   04062 Chemokine signaling pathway
    108393746 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108393746 (AKT3)
   04922 Glucagon signaling pathway
    108393746 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    108393746 (AKT3)
   04920 Adipocytokine signaling pathway
    108393746 (AKT3)
   04929 GnRH secretion
    108393746 (AKT3)
   04915 Estrogen signaling pathway
    108393746 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    108393746 (AKT3)
   04917 Prolactin signaling pathway
    108393746 (AKT3)
   04926 Relaxin signaling pathway
    108393746 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    108393746 (AKT3)
   04919 Thyroid hormone signaling pathway
    108393746 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108393746 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108393746 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    108393746 (AKT3)
   04728 Dopaminergic synapse
    108393746 (AKT3)
   04722 Neurotrophin signaling pathway
    108393746 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108393746 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    108393746 (AKT3)
   04213 Longevity regulating pathway - multiple species
    108393746 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108393746 (AKT3)
   05205 Proteoglycans in cancer
    108393746 (AKT3)
   05230 Central carbon metabolism in cancer
    108393746 (AKT3)
   05231 Choline metabolism in cancer
    108393746 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108393746 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108393746 (AKT3)
   05212 Pancreatic cancer
    108393746 (AKT3)
   05225 Hepatocellular carcinoma
    108393746 (AKT3)
   05226 Gastric cancer
    108393746 (AKT3)
   05214 Glioma
    108393746 (AKT3)
   05221 Acute myeloid leukemia
    108393746 (AKT3)
   05220 Chronic myeloid leukemia
    108393746 (AKT3)
   05218 Melanoma
    108393746 (AKT3)
   05211 Renal cell carcinoma
    108393746 (AKT3)
   05215 Prostate cancer
    108393746 (AKT3)
   05213 Endometrial cancer
    108393746 (AKT3)
   05224 Breast cancer
    108393746 (AKT3)
   05222 Small cell lung cancer
    108393746 (AKT3)
   05223 Non-small cell lung cancer
    108393746 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108393746 (AKT3)
   05017 Spinocerebellar ataxia
    108393746 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108393746 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108393746 (AKT3)
   04931 Insulin resistance
    108393746 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108393746 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108393746 (AKT3)
   05135 Yersinia infection
    108393746 (AKT3)
   05152 Tuberculosis
    108393746 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108393746 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    108393746 (AKT3)
   05161 Hepatitis B
    108393746 (AKT3)
   05160 Hepatitis C
    108393746 (AKT3)
   05164 Influenza A
    108393746 (AKT3)
   05162 Measles
    108393746 (AKT3)
   05168 Herpes simplex virus 1 infection
    108393746 (AKT3)
   05163 Human cytomegalovirus infection
    108393746 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108393746 (AKT3)
   05169 Epstein-Barr virus infection
    108393746 (AKT3)
   05165 Human papillomavirus infection
    108393746 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108393746 (AKT3)
   05142 Chagas disease
    108393746 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108393746 (AKT3)
   01524 Platinum drug resistance
    108393746 (AKT3)
   01522 Endocrine resistance
    108393746 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108393746 (AKT3)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108393746 (AKT3)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   108393746 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C PH FTA2
Other DBs
NCBI-GeneID: 108393746
NCBI-ProteinID: XP_017510281
LinkDB
Position
Unknown
AA seq 418 aa
MKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSP
TSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKK
EVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRER
VFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILME
DIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPP
FKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggaccact
gttatagaaagaacatttcatgtagacactccagaagaaagggaagaatggacagaagct
atccaggctgtggcagatagacttcagaggcaagaagaggagagaatgaattgtagtcca
acttcacaaatagataacataggggaagaagagatggatgcttctactacccatcataaa
agaaagacaatgaatgattttgactatttgaaactactaggtaaaggaacttttggaaaa
gttattttggttcgagagaaggcaagtgggaaatactatgctatgaaaattctgaagaaa
gaagttattattgcaaaggatgaagtggcacacactctaactgaaagcagagtgttaaag
aacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgatta
tgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagagcgg
gtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggactat
ctacattctggaaagattgtgtaccgcgatctcaagttggaaaatttgatgctggataaa
gatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgcagct
accatgaagacgttctgtggaacaccagaatacctggcaccagaggtgttagaagataat
gactatggccgagctgtggattggtggggcctcggggttgtcatgtacgaaatgatgtgt
gggagattacctttctacaaccaggatcatgagaaactttttgaactaatactaatggaa
gacattaaatttcctcgaaccctctcttcagatgcaaaatcattgctttcagggctcttg
ataaaggatccaaataaacgtcttggtggaggaccagatgatgcaaaagaaattatgaga
cacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtgcctcct
tttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttacagct
caaactattacaataacaccacctgaaaaatacgatgaggacggcatggactgcgtggac
aacgagcggcggccgcacttcccccagttctcctactctgcgagcgggcgggagtaa

KEGG   Manis javanica (Malayan pangolin): 108397433
Entry
108397433         CDS       T06054                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04371  Apelin signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04725  Cholinergic synapse
mjv04728  Dopaminergic synapse
mjv04910  Insulin signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04922  Glucagon signaling pathway
mjv04923  Regulation of lipolysis in adipocytes
mjv04926  Relaxin signaling pathway
mjv04929  GnRH secretion
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv04973  Carbohydrate digestion and absorption
mjv05010  Alzheimer disease
mjv05017  Spinocerebellar ataxia
mjv05132  Salmonella infection
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108397433 (AKT1)
   04012 ErbB signaling pathway
    108397433 (AKT1)
   04014 Ras signaling pathway
    108397433 (AKT1)
   04015 Rap1 signaling pathway
    108397433 (AKT1)
   04370 VEGF signaling pathway
    108397433 (AKT1)
   04371 Apelin signaling pathway
    108397433 (AKT1)
   04630 JAK-STAT signaling pathway
    108397433 (AKT1)
   04668 TNF signaling pathway
    108397433 (AKT1)
   04066 HIF-1 signaling pathway
    108397433 (AKT1)
   04068 FoxO signaling pathway
    108397433 (AKT1)
   04072 Phospholipase D signaling pathway
    108397433 (AKT1)
   04071 Sphingolipid signaling pathway
    108397433 (AKT1)
   04024 cAMP signaling pathway
    108397433 (AKT1)
   04022 cGMP-PKG signaling pathway
    108397433 (AKT1)
   04151 PI3K-Akt signaling pathway
    108397433 (AKT1)
   04152 AMPK signaling pathway
    108397433 (AKT1)
   04150 mTOR signaling pathway
    108397433 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108397433 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    108397433 (AKT1)
   04218 Cellular senescence
    108397433 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108397433 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108397433 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108397433 (AKT1)
   04613 Neutrophil extracellular trap formation
    108397433 (AKT1)
   04620 Toll-like receptor signaling pathway
    108397433 (AKT1)
   04625 C-type lectin receptor signaling pathway
    108397433 (AKT1)
   04660 T cell receptor signaling pathway
    108397433 (AKT1)
   04662 B cell receptor signaling pathway
    108397433 (AKT1)
   04664 Fc epsilon RI signaling pathway
    108397433 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    108397433 (AKT1)
   04062 Chemokine signaling pathway
    108397433 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108397433 (AKT1)
   04922 Glucagon signaling pathway
    108397433 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    108397433 (AKT1)
   04920 Adipocytokine signaling pathway
    108397433 (AKT1)
   04929 GnRH secretion
    108397433 (AKT1)
   04915 Estrogen signaling pathway
    108397433 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    108397433 (AKT1)
   04917 Prolactin signaling pathway
    108397433 (AKT1)
   04926 Relaxin signaling pathway
    108397433 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    108397433 (AKT1)
   04919 Thyroid hormone signaling pathway
    108397433 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108397433 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    108397433 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    108397433 (AKT1)
   04728 Dopaminergic synapse
    108397433 (AKT1)
   04722 Neurotrophin signaling pathway
    108397433 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108397433 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    108397433 (AKT1)
   04213 Longevity regulating pathway - multiple species
    108397433 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397433 (AKT1)
   05205 Proteoglycans in cancer
    108397433 (AKT1)
   05230 Central carbon metabolism in cancer
    108397433 (AKT1)
   05231 Choline metabolism in cancer
    108397433 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108397433 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108397433 (AKT1)
   05212 Pancreatic cancer
    108397433 (AKT1)
   05225 Hepatocellular carcinoma
    108397433 (AKT1)
   05226 Gastric cancer
    108397433 (AKT1)
   05214 Glioma
    108397433 (AKT1)
   05221 Acute myeloid leukemia
    108397433 (AKT1)
   05220 Chronic myeloid leukemia
    108397433 (AKT1)
   05218 Melanoma
    108397433 (AKT1)
   05211 Renal cell carcinoma
    108397433 (AKT1)
   05215 Prostate cancer
    108397433 (AKT1)
   05213 Endometrial cancer
    108397433 (AKT1)
   05224 Breast cancer
    108397433 (AKT1)
   05222 Small cell lung cancer
    108397433 (AKT1)
   05223 Non-small cell lung cancer
    108397433 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108397433 (AKT1)
   05017 Spinocerebellar ataxia
    108397433 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108397433 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108397433 (AKT1)
   04931 Insulin resistance
    108397433 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108397433 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108397433 (AKT1)
   05135 Yersinia infection
    108397433 (AKT1)
   05152 Tuberculosis
    108397433 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108397433 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    108397433 (AKT1)
   05161 Hepatitis B
    108397433 (AKT1)
   05160 Hepatitis C
    108397433 (AKT1)
   05164 Influenza A
    108397433 (AKT1)
   05162 Measles
    108397433 (AKT1)
   05168 Herpes simplex virus 1 infection
    108397433 (AKT1)
   05163 Human cytomegalovirus infection
    108397433 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108397433 (AKT1)
   05169 Epstein-Barr virus infection
    108397433 (AKT1)
   05165 Human papillomavirus infection
    108397433 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108397433 (AKT1)
   05142 Chagas disease
    108397433 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108397433 (AKT1)
   01524 Platinum drug resistance
    108397433 (AKT1)
   01522 Endocrine resistance
    108397433 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108397433 (AKT1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108397433 (AKT1)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   108397433 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 108397433
NCBI-ProteinID: XP_017516354
LinkDB
Position
Unknown
AA seq 480 aa
MNDGAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQRECPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEELMDF
RSGSPGDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMGEIRFPRTLSPEARCLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIMWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDHMEGVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacggggccatcgtaaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccccggtacttccttctcaagagtgatggcaccttcatcggctacaaggag
cggccgcaggacgtggaccagcgcgagtgccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacagagcggcccaggcccaacacgttcatcatccggtgtctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacccccgaggagcgggaggagtggacc
actgccatccagacggtggccgatgggctcaagcggcaggaggaggagttgatggacttc
cggtcggggtcgcccggggacaactctggggccgaggagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagcttctgggcaaaggcacc
tttgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatt
ctgaagaaggaggtcatcgtggccaaggacgaggtggcccacacactcacggagaaccgc
gtcctgcagaactcccggcacccgttcctgacagctctcaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctcttcttccacctgtcc
cgggagcgggtgttccccgaggaccgggcccgcttctacggtgccgagatcgtgtcggcc
ctggactacctgcactcggagaagaacgtggtctaccgcgacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcacggacttcggcctgtgcaaggagggcatc
aaggacggtgccaccatgaagaccttctgcgggacgcccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatgggggagatccgcttcccgcgcacgctcagccccgaggccaggtgcctgctc
tcggggctgctcaagaaggaccccaagcagaggcttggtgggggctccgaggatgccaag
gagataatgcagcaccgcttctttgccggcatcatgtggcaggacgtgtacgagaagaag
ctgagtccgcccttcaagccccaggtcacgtcggagacggacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacgccgcctgaccaagatgaccacatggagggc
gtggacagcgagcgaagaccccacttcccccagttctcctactcggccagtggcacagcc
tga

DBGET integrated database retrieval system