KEGG   Manis javanica (Malayan pangolin): 108390746
Entry
108390746         CDS       T06054                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04012  ErbB signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04136  Autophagy - other
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04218  Cellular senescence
mjv04371  Apelin signaling pathway
mjv04613  Neutrophil extracellular trap formation
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv04714  Thermogenesis
mjv04910  Insulin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05221  Acute myeloid leukemia
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108390746 (MTOR)
   04371 Apelin signaling pathway
    108390746 (MTOR)
   04630 JAK-STAT signaling pathway
    108390746 (MTOR)
   04066 HIF-1 signaling pathway
    108390746 (MTOR)
   04072 Phospholipase D signaling pathway
    108390746 (MTOR)
   04151 PI3K-Akt signaling pathway
    108390746 (MTOR)
   04152 AMPK signaling pathway
    108390746 (MTOR)
   04150 mTOR signaling pathway
    108390746 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108390746 (MTOR)
   04136 Autophagy - other
    108390746 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    108390746 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108390746 (MTOR)
   04659 Th17 cell differentiation
    108390746 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108390746 (MTOR)
   04920 Adipocytokine signaling pathway
    108390746 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    108390746 (MTOR)
   04919 Thyroid hormone signaling pathway
    108390746 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    108390746 (MTOR)
   04213 Longevity regulating pathway - multiple species
    108390746 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    108390746 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108390746 (MTOR)
   05206 MicroRNAs in cancer
    108390746 (MTOR)
   05205 Proteoglycans in cancer
    108390746 (MTOR)
   05230 Central carbon metabolism in cancer
    108390746 (MTOR)
   05231 Choline metabolism in cancer
    108390746 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108390746 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108390746 (MTOR)
   05212 Pancreatic cancer
    108390746 (MTOR)
   05225 Hepatocellular carcinoma
    108390746 (MTOR)
   05226 Gastric cancer
    108390746 (MTOR)
   05214 Glioma
    108390746 (MTOR)
   05221 Acute myeloid leukemia
    108390746 (MTOR)
   05215 Prostate cancer
    108390746 (MTOR)
   05224 Breast cancer
    108390746 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108390746 (MTOR)
   05014 Amyotrophic lateral sclerosis
    108390746 (MTOR)
   05016 Huntington disease
    108390746 (MTOR)
   05017 Spinocerebellar ataxia
    108390746 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    108390746 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108390746 (MTOR)
   04931 Insulin resistance
    108390746 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108390746 (MTOR)
   05168 Herpes simplex virus 1 infection
    108390746 (MTOR)
   05163 Human cytomegalovirus infection
    108390746 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108390746 (MTOR)
   05165 Human papillomavirus infection
    108390746 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108390746 (MTOR)
   01522 Endocrine resistance
    108390746 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108390746 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108390746 (MTOR)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108390746 (MTOR)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108390746 (MTOR)
Membrane trafficking [BR:mjv04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    108390746 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase FRB_dom FATC TPR_19 Nipped-B_C
Other DBs
NCBI-GeneID: 108390746
NCBI-ProteinID: XP_017505458
LinkDB
Position
Unknown
AA seq 1538 aa
FLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLY
LPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLP
SRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQI
FIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPV
ETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAY
NPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKG
PLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAA
GVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEW
GQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVL
ALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPE
RREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAH
KTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQH
AIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAW
HAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITSTATAATTATTATATSTEGSNSES
EAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWF
DYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQA
LIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGL
EEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKS
GNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPII
RIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLAN
DPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRM
APDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVG
YILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTG
LDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSA
GQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGR
DFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 4617 nt   +upstreamnt  +downstreamnt
ttcctgttccagcagctgggaatgttggtgtcatttgtgaagagccacatcagaccttac
atggatgaaatagtcaccctcatgagagaattctgggtcatgaatacctcaatccaaagc
actatcattcttctcatcgagcaaattgtggtagctcttgggggtgaatttaagctctac
ctgccccagctgatcccacacatgctacgtgtcttcatgcatgacaacagcccagggcgc
atcgtctccatcaagctgttggctgccatccagctgtttggtgccaacctggacgactat
ctgcatttgttgctgccccctatcgtgaagttgtttgatgcccctgaagttccactgcca
tctcgaaaggcagcattagagacagtggaccgcctgacagagtccctggacttcactgac
tatgcctcccgaatcatccacccaattgttcgaacgctggaccagagcccagaactgcgt
cccacagccatggacacgctgtcttcacttgtctttcagctggggaagaagtaccaaatt
ttcattcccatggtgaacaaagttctcgtgcgacaccgaatcaaccatcagcgctatgat
gtcctcatttgcagaattgtcaagggatacacccttgctgatgaagaagaggaccctttg
atttaccagcatcgaatgctgaggagtggccaaggagatgcactggctagtggaccagta
gaaacaggacccatgaagaaactgcatgtcagcaccatcaaccttcaaaaggcctgggga
gctgccagaagggtctccaaagacgattggctggaatggctgaggcggctgagtctggag
ctgctgaaggactcctcttcgccctccctgcgctcctgctgggccctggctcaggcctac
aacccaatggccagggatctcttcaatgctgcatttgtgtcctgctggtctgaactgaat
gaggaccagcaggatgaactcatccgaagcattgaattagccctcacctcacaggatatt
gctgaagtcacacaaaccctcttgaacttggctgaatttatggaacacagtgacaagggc
cccctgccattgagagatgacaatggcattgttctgctgggtgagagggctgccaagtgc
cgagcctatgccaaagcgctacactacaaagaactggagttccagaaaggtcccacccct
gccatcctagagtctctcatcagcattaataataagctacagcagccagaagcagctgcc
ggggtgttagaatatgccatgaaacacttcggagagctggagatccaggccacctggtat
gagaaactgcatgagtgggaggacgcccttgtagcctatgataagaaaatggacaccaac
aaggatgacccggagctgatgctgggccgtatgcgctgccttgaggccttgggggaatgg
ggacagctccatcagcagtgctgtgaaaagtggaccctggttaatgatgaaacccaagcc
aagatggcccggatggctgctgcagctgcttggggcttaggtcagtgggacagcatggaa
gaatacacctgtatgatccctcgggacacccacgatggggcattttatagagctgtgctg
gcactacatcaggacctcttctccttggcacaacagtgcattgacaaagccagggacctg
ctggatgccgagttaactgccatggcaggagagagctacagtcgggcatatggggccatg
gtttcttgccacatgctctctgagctggaggaggttatccagtacaaacttgtccctgag
cgccgagagatcatccggcagatctggtgggagagactgcagggctgccagcgtattgtg
gaggactggcagaagattctgatggtgcggtcgcttgtggtcaaccctcatgaggacatg
cggacctggctcaagtacgcaagcctgtgtggcaagagtggaaggctggctcttgctcat
aaaaccttagtgttgctcctgggagttgacccatctcggcaacttgaccatcccctgcca
acagttcaccctcaggtgacctatgcctacatgaaaaacatgtggaagagtgcccgcaag
attgatgccttccagcacatgcagcacttcgttcagaccgtgcagcagcaagcccagcac
gccatcgctaccgaggaccagcagcataagcaagagctgcacaagctcatggcccgatgt
tttctgaaactcggggagtggcagctgaacttacagggcatcaacgagagcacgatcccc
aaagtcctgcagtactacagtgctgccacggagcatgaccgcagctggtacaaggcctgg
cacgcatgggcagtgatgaactttgaagctgtgctacactataaacatcagaaccaagcc
cgtgacgagaaaaagaagctgcgtcatgccagtggggccaacatcaccagcacagccacc
gctgccaccacagcgaccaccgccacggccaccagcaccgagggcagcaacagcgagagt
gaggccgagagcacagagaacagccccaccccttcccctctgcagaagaaggtcaccgag
gatctgtccaaaaccctcctgatgtacaccgtccctgccgtccagggcttcttccgttcc
atctccttgtcacggggcaacaatctccaggatacgctcagagtcctcaccttatggttt
gattatggtcattggccagatgtaaatgaagccttagtggaaggggtgaaagccatccag
attgacacttggttacaggttatacctcagctcattgcaagaatcgatacgcctaggccc
ttggtgggacgtctcattcaccagcttctcaccgacattggtcggtaccacccacaggcc
ctcatctaccccctgaccgttgcttctaagtctaccaccacagcccgtcacaacgcagcc
aacaagattctgaagaacatgtgcgagcacagtaacaccctggtacagcaagccatgatg
gtgagtgaggagctaatccgagtggccatcctctggcatgagatgtggcatgaaggcctg
gaagaagcgtctcgtttgtacttcggggagaggaacgtgaaaggcatgtttgaggtgctg
gagcccctgcatgctatgatggagcggggaccgcagactctgaaggagacatcctttaac
caggcatatggtcgagatttaatggaggcccaggagtggtgccggaagtacatgaagtca
gggaatgtcaaggacctcacccaagcctgggacctctactaccacgtgttcagaagaatc
tcaaagcagctgccgcagctcacatccttagagctgcagtatgtttccccaaaacttctg
atgtgccgggacctcgaattggctgtaccaggaacttacgaccccaaccagccaatcatt
cgcattcagtcgatagcaccgtctttgcaagtcatcacatccaagcagaggccccggaag
ttgacactcatgggcagcaacgggcatgagtttgttttcctcctgaagggccacgaggat
ctgcggcaggacgagcgagtgatgcagctcttcggcctggtcaacaccctcctggccaac
gaccccacatctcttcggaagaacctcagcatccagagatatgcagtcatccccttatca
accaactcgggcctcatcggctgggtcccccactgtgacacactgcacgccctcatccgg
gactacagggagaaaaagaagatccttctcaatatcgagcaccgcatcatgttacggatg
gctccagactacgatcacctgactctgatgcagaaggtggaggtgtttgaacacgctgtc
aataatacagctggggatgacctggccaagctgctatggctaaaaagccccagctctgag
gtgtggtttgaccgaagaaccaattacacccgctctttagcggtcatgtccatggttggg
tatattttgggcctgggagatagacatccgtccaacctaatgctggaccggctgagtggg
aagatactgcacattgactttggggactgcttcgaggttgctatgaccagagagaagttc
ccagagaagattccgtttagactaacaagaatgttgaccaatgccatggaggttactggt
ctggacggcaactacagaatcacatgccacacagtgatggaagtgcttcgagaacacaaa
gatagtgtcatggccgtgctggaagcctttgtctatgaccccttgctgaactggaggctg
atggacacaaataccaaaggtaacaagcggtcccgaacgaggacagattcctactctgct
ggccagtcagtagaaattttggatggtgtggaacttggggaaccagcccataagaaaaca
gggaccacagtgccagagtctattcattctttcattggagatggtttggtgaaaccagag
gccctgaacaagaaagctattcagattattaacagggttcgagataagctcactggtcgg
gacttctctcatgatgaaaccttggatgtcccaacgcaagttgagctgctcatcaaacaa
gcaacgtcccatgaaaacctctgccagtgctacatcggctggtgtcctttctggtaa

KEGG   Manis javanica (Malayan pangolin): 108399184
Entry
108399184         CDS       T06054                                 

Definition
(RefSeq) serine/threonine-protein kinase mTOR-like
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04012  ErbB signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04136  Autophagy - other
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04218  Cellular senescence
mjv04371  Apelin signaling pathway
mjv04613  Neutrophil extracellular trap formation
mjv04630  JAK-STAT signaling pathway
mjv04659  Th17 cell differentiation
mjv04714  Thermogenesis
mjv04910  Insulin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04930  Type II diabetes mellitus
mjv04931  Insulin resistance
mjv04935  Growth hormone synthesis, secretion and action
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05221  Acute myeloid leukemia
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108399184
   04371 Apelin signaling pathway
    108399184
   04630 JAK-STAT signaling pathway
    108399184
   04066 HIF-1 signaling pathway
    108399184
   04072 Phospholipase D signaling pathway
    108399184
   04151 PI3K-Akt signaling pathway
    108399184
   04152 AMPK signaling pathway
    108399184
   04150 mTOR signaling pathway
    108399184
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108399184
   04136 Autophagy - other
    108399184
  09143 Cell growth and death
   04218 Cellular senescence
    108399184
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108399184
   04659 Th17 cell differentiation
    108399184
  09152 Endocrine system
   04910 Insulin signaling pathway
    108399184
   04920 Adipocytokine signaling pathway
    108399184
   04935 Growth hormone synthesis, secretion and action
    108399184
   04919 Thyroid hormone signaling pathway
    108399184
  09149 Aging
   04211 Longevity regulating pathway
    108399184
   04213 Longevity regulating pathway - multiple species
    108399184
  09159 Environmental adaptation
   04714 Thermogenesis
    108399184
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108399184
   05206 MicroRNAs in cancer
    108399184
   05205 Proteoglycans in cancer
    108399184
   05230 Central carbon metabolism in cancer
    108399184
   05231 Choline metabolism in cancer
    108399184
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108399184
  09162 Cancer: specific types
   05210 Colorectal cancer
    108399184
   05212 Pancreatic cancer
    108399184
   05225 Hepatocellular carcinoma
    108399184
   05226 Gastric cancer
    108399184
   05214 Glioma
    108399184
   05221 Acute myeloid leukemia
    108399184
   05215 Prostate cancer
    108399184
   05224 Breast cancer
    108399184
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108399184
   05014 Amyotrophic lateral sclerosis
    108399184
   05016 Huntington disease
    108399184
   05017 Spinocerebellar ataxia
    108399184
   05022 Pathways of neurodegeneration - multiple diseases
    108399184
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108399184
   04931 Insulin resistance
    108399184
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108399184
   05168 Herpes simplex virus 1 infection
    108399184
   05163 Human cytomegalovirus infection
    108399184
   05167 Kaposi sarcoma-associated herpesvirus infection
    108399184
   05165 Human papillomavirus infection
    108399184
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108399184
   01522 Endocrine resistance
    108399184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108399184
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108399184
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108399184
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108399184
Membrane trafficking [BR:mjv04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    108399184
SSDB
Motif
Pfam: DUF3385 HEAT_2 HEAT_EZ Adaptin_N IFRD V-ATPase_H_N EPSP_synthase
Other DBs
NCBI-GeneID: 108399184
NCBI-ProteinID: XP_017519290
LinkDB
Position
Unknown
AA seq 1013 aa
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPTKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEVRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREVSG
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccacagctaccaccacttccagcaatgtgagc
gttctgcagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagcg
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
acccgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcggatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggcagatttgctaactaccttcggaacctcctcccctctaatgaccca
gttgtcatggaaatggcatccaaggccattggtcgccttgccatggcaggggacactttt
accgctgagtatgtggagtttgaagtgaagcgagccctggagtggcttggtgctgaccgc
aatgagggccggagacacgcagctgttctggttctccgtgagctggccatcagtgtcccc
accttcttcttccagcaagtacaacccttctttgacaatatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtcgccgcccttcgtgcttgtctgattctcacc
acccagcgtgaaccgaaggagatgcagaagccccagtggtacaggcacacgttcgaagaa
gcagagaaagggtttgatgagactttggccaaggagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatcctcaacgagctcgtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctggtccatgacaagtactgc
aaagatctcatgggcttcggaacaaaaccgcgtcacatcacccccttcaccagcttccag
gctgtacagccccagcagtcaaacgcgttggtgggactgctggggtacagttctcaccaa
ggcctcatgggatttggggcttcccccagcccaactaagtccactctggtggagagtcga
tgttgcagagacttgatggaggaaaaatttgaccaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccagatgacgattcttaatttgttgccccgcttggct
gcattccggccttctgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgccccctaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acagtgttcacttgcatcagcatgctggctcgagcaatggggccaggtatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctctacgacctgagccgtcaaattccacagctgaagaaggatatccaagatgggctactg
aagatgctgtcccttgtcctcatgcacaaacccctccgtcatccaggcatgcccaagggc
ctggcccatcagctggcttcccctggactcacaacccttcccgaggccagcgatgtgggc
agtattactcttgccctccgaactcttggcagctttgaatttgaaggccactctctgacc
cagtttgtccggcactgtgcagatcatttcctaaacagtgagcacaaagaggtccggatg
gaagctgcccgcacctgttcccgcctgctcacaccctctgtccacctcatcagcggccat
gctcatgtggttagccagactgcagtgcaagtggtggcagatgtgctcagcaaattgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggccgagaatttgcaggccctgtttgtggccctg
aatgaccaagtgtttgagatccgggagctggccatctgcaccgtaggccgactcagtagc
atgaacccagctttcgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattggaagaattaaagaacagagtgcccgcatgctggggcacctg
gtctccaatgccccccggctcatccgcccctacatggagcctatcctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagaattggctcaggttagtggcctagaaatgaggaaatgggttgatgagctt
tttattatcatcatggatatgctccaggactcctctctgttggccaaaaggcaggtggcc
ctatggacactgggacagctggtggccagcactggctatgtggtggagccctacaggaag
tatcccactttgcttgaggtgctgctaaattttctgaagactgagcagaaccagggtaca
cggagagaggccatccgtgtgttagggcttttgggggccttggatccctacaagcacaaa
gtgaacatcggcatgatagaccagtcccgtgatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcccctggacgagttctacccagccgtgtccatggtggccctgatgcggatcttccga
gaccagtcactgtctcaccatcacaccatggttgtccaggctatcaccttcatcttcaag
tccttggggctcaagtgtgtgcagttcctgccccaggtcatgcctactttcctgaatgtc
attcgggtctgtgatggggccatccgggaagtaagtggctaa

DBGET integrated database retrieval system