KEGG   Manis javanica (Malayan pangolin): 108391030
Entry
108391030         CDS       T06054                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04390  Hippo signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05200  Pathways in cancer
mjv05218  Melanoma
mjv05224  Breast cancer
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108391030 (FGF1)
   04014 Ras signaling pathway
    108391030 (FGF1)
   04015 Rap1 signaling pathway
    108391030 (FGF1)
   04390 Hippo signaling pathway
    108391030 (FGF1)
   04151 PI3K-Akt signaling pathway
    108391030 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108391030 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108391030 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    108391030 (FGF1)
   05218 Melanoma
    108391030 (FGF1)
   05224 Breast cancer
    108391030 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108391030 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108391030 (FGF1)
Cytokines and growth factors [BR:mjv04052]
 Growth factors
  Growth factors (RTK binding)
   108391030 (FGF1)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108391030 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108391030
NCBI-ProteinID: XP_017505896
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFSALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPDEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggaaatcacaactttctcagccctgaccgagaagttcaatctgcctccg
gggaattacaagaagcccaaactcctctactgcagcaacgggggccacttcctgaggatc
cttccagatggcaccgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtactgagaccggccagtacttg
gccatggacaccgacggtctcttatacggctcacagacaccagatgaggaatgtttgttt
ctggaaaggctggaggaaaaccattacaatacctacacgtccaagaagcacgccgaaaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system