KEGG   Manis javanica (Malayan pangolin): 108391263
Entry
108391263         CDS       T06054                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv05160  Hepatitis C
mjv05162  Measles
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391263 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108391263 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108391263 (IRF9)
   04625 C-type lectin receptor signaling pathway
    108391263 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108391263 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    108391263 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108391263 (IRF9)
   05171 Coronavirus disease - COVID-19
    108391263 (IRF9)
   05164 Influenza A
    108391263 (IRF9)
   05162 Measles
    108391263 (IRF9)
   05168 Herpes simplex virus 1 infection
    108391263 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108391263 (IRF9)
   05169 Epstein-Barr virus infection
    108391263 (IRF9)
   05165 Human papillomavirus infection
    108391263 (IRF9)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    108391263 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF DUF4685
Other DBs
NCBI-GeneID: 108391263
NCBI-ProteinID: XP_017506322
LinkDB
Position
Unknown
AA seq 405 aa
MASGRARSTRKLRNWVVEQLESGLFPGVCWYDAAKTMFQIPWKHAGKQDFREDQDAAFFK
AWAMFKGKYKEGDAEGPAIWKTRLRCALNKSPEFEEVPENGHRDGAEPYKVYRLLPPGTL
PAQPETQKSPLKRPHSSVSSEREGSTKNCTLSPSSLQDPLRKEEVGASGEAGHSDSGSSR
SSLEPREGTDTPEAPFQGDQVSLELLPPPDSDYSLLLTFIYNGHVVGEAQVQSLDCRLVA
EPLGSQCGMEQVVFPKPGPQEPTQRLLSQLKRGVLVASNSRGLFVQRLCPIPISWNAPYS
PPGPGPHLLPSNKCVELFRTAYFCRDLAKYSQGLGPPPKFQVTLNFWEENPGPSHTPQSL
ITVQMEQAFARHLLEETPEEQAATLSLVQSLGDPPSSPPLSSSYL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcatcaggcagggcacgcagcacccgaaagctccggaactgggtggtggagcaactg
gagagcgggctcttcccaggggtgtgctggtatgatgcagcgaagacaatgttccagatt
ccctggaagcacgcaggcaagcaggacttccgggaggatcaggatgctgctttcttcaag
gcctgggcaatgtttaagggaaagtacaaggagggggatgcagaaggccctgctatctgg
aagactcgtctgcgctgtgccctcaacaagagtcctgaatttgaggaggttcctgagaat
ggccatagggatggggctgagccttacaaggtgtaccggctgctgccaccaggaaccctc
cctgcccagccagagacccagaaatcaccattaaagcgaccccacagttctgtgtcctca
gagagggaaggttccacaaagaactgcacactcagtccctcctcactccaggaccccctc
agaaaggaggaggtgggggccagtggggaagcaggccattcagactctgggagcagcagg
agcagcctggagcctcgggaaggtacagacacacctgaggcccctttccaaggagatcag
gtgtccctggagcttctgcctcctccagactcagactactcgctgttgcttaccttcatc
tacaatgggcacgtggtgggggaggcccaggtgcagagcctggactgccgccttgtggct
gagcccttgggctcccagtgcggaatggagcaggtggtatttcccaagcctggtccacaa
gagcctacccagcgcctgctcagccaactcaagagaggtgtcctggtggccagcaactcc
cgaggcctcttcgtccagcgtctttgccctatccccatctcctggaacgcgccctactcc
cctcctggtccaggcccgcatctgctgcccagcaacaagtgcgtggagctttttagaact
gcctacttctgcagagacttggccaagtactcccagggcctgggcccaccacccaagttc
caggtaacactgaatttctgggaggagaaccctggccccagccacaccccacagagtctt
atcacagtgcagatggagcaggcctttgcccgacatttactggaggagacaccggaggag
caggcagccactctgtccctggtgcagagcctgggggacccaccttcctcccctcctctc
tcttcctcctatctttga

DBGET integrated database retrieval system