KEGG   Manis javanica (Malayan pangolin): 108391417
Entry
108391417         CDS       T06054                                 

Definition
(RefSeq) tyrosine-protein kinase ZAP-70 isoform X1
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04014  Ras signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv05135  Yersinia infection
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108391417
   04064 NF-kappa B signaling pathway
    108391417
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108391417
   04660 T cell receptor signaling pathway
    108391417
   04658 Th1 and Th2 cell differentiation
    108391417
   04659 Th17 cell differentiation
    108391417
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108391417
  09163 Immune disease
   05340 Primary immunodeficiency
    108391417
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108391417
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108391417
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  SYK family
   108391417
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo Haspin_kinase RIO1
Other DBs
NCBI-GeneID: 108391417
NCBI-ProteinID: XP_017506496
LinkDB
Position
Unknown
AA seq 619 aa
MPDPAAHLPFFYGNISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGFEPQPGVFDSLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEHGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEPCPNTSASTSSGAAAPTLPAHPSTFTQPQRRIDTLNSDGYTPEPARLA
SPEKLRPMPMDTSVYESPYSDPEELKDRKLFLKRENLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKHSTEKADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLLGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPY
KKMKGPEVISFIEQGKRMECPPECPAEMYTLMSDCWTYKWEDRPDFLAVEQRMRAYHYSL
AGKAEGASAGGKGADAACA
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgccggaccccgcggcgcacctgcccttcttctacggcaacatctcgcgcgccgaggcc
gaggagcacctgaagctggcgggcatggcagatgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctacgtgctctcgctcgtgcacgatgtgcgcttccaccacttcccc
atagagcgccagctcaatggcacctacgccatcgcgggcggtaaggcgcactgcggccct
gcagagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgcaag
ccatgcaaccggccgtctgggttcgagccgcagcccggggtcttcgacagtctgcgcgac
gccatggtgcgtgactacgtgcgccagacgtggaaactggagggcgaggccctggagcag
gccatcatcagccaagccccccaggtggagaagctcattgccactacggctcacgaacgg
atgccctggtaccacagcagcctgacgcgcgaggaggccgagcgcaaactgtattcaggc
tcgcagaccgacggcaagttcctgctgaggccccggaaggagcacggcacgtatgcactg
tccctgatctacgggaaaaccgtgtaccactacctcatcagccaggacaaggcgggcaaa
tactgcattcctgaggggaccaagtttgacacgctctggcagctggtagagtacctgaag
ctaaaggctgacgggctcatctactgcctgaaggagccctgtcccaacaccagtgccagc
accagctcaggggctgctgctcccacactcccagcccacccatccaccttcacccaacct
cagagacggatcgacaccctcaactcagatggatacacccctgaaccagcacgtctagca
tccccagagaaactgcggccgatgcccatggacacaagcgtgtatgagagcccctacagt
gaccccgaggagctcaaggacaggaagctcttcctgaagcgtgagaacctcctcatagct
gacatagaacttggctgcgggaacttcggctcagtgcgccagggtgtctaccgcatgcgc
aagaagcagatcgatgtggccatcaaggtgttgaaacacagcacagagaaggcagacaag
gatgaaatgatgcgtgaggcacagatcatgcaccagctggacaacccctacattgtgcgg
ctcatcggcgtctgccaggccgaggccctcatgctcgtcatggagatggcgggcggtggg
cccctgcacaagttcctgcttggcaagaaggaggagatccccgtcagcaatgtggcagag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaacttcgtgcaccgc
gacctggcggcacgcaacgtgctgctggtcaaccggcactatgccaagatcagtgacttt
ggcctctccaaggccctgggagccgacgacagctactacaccgcccgctctgctgggaag
tggccgcttaagtggtacgcgcctgagtgcatcaacttccgcaagttctccagccgcagt
gatgtttggagctatggggtcaccatgtgggaggccttctcctatggccagaagccctac
aagaagatgaagggccccgaggtcataagcttcatcgagcagggtaagcggatggagtgc
ccgccagagtgtccggctgaaatgtataccctcatgagcgactgctggacctacaagtgg
gaggatcgcccagacttcctggcggtggagcagcgcatgcgggcctaccactacagcttg
gcgggcaaggccgagggcgcctcagcgggcggaaagggggctgatgctgcctgtgcctga

DBGET integrated database retrieval system