KEGG   Manis javanica (Malayan pangolin): 108391579
Entry
108391579         CDS       T06054                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00280  Valine, leucine and isoleucine degradation
mjv00350  Tyrosine metabolism
mjv00380  Tryptophan metabolism
mjv00750  Vitamin B6 metabolism
mjv00760  Nicotinate and nicotinamide metabolism
mjv00830  Retinol metabolism
mjv00982  Drug metabolism - cytochrome P450
mjv01100  Metabolic pathways
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108391579 (AOX1)
   00350 Tyrosine metabolism
    108391579 (AOX1)
   00380 Tryptophan metabolism
    108391579 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    108391579 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    108391579 (AOX1)
   00830 Retinol metabolism
    108391579 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    108391579 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391579 (AOX1)
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     108391579 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 108391579
NCBI-ProteinID: XP_017506710
LinkDB
Position
Unknown
AA seq 1338 aa
MDAAAELLFYVNGRQVIEKNVDPETMLLPYLRKKLRLTGTKYGCGSGGCGACTVMVSRYN
PITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKARIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHLEPSLDQLTDALGGNLCRCTGYRPIIDTCKTFCTTSGCCQSKENGICC
LDQGINELPEFEEGNKTSTKLFSEEEFLPLDPTQELIFPPELMIMAEKQPQRTRIFGGER
MTWISPVTLKELIEAKAKYPQAPVVMGNTSVGPEMKFKGIFYPVIISPDGIVDLTVMNYA
SNELTLGAGLSLAQVKDILADLILKLPEEKTQMYQALLKHLRTLAGSQIRNMASLGGHIV
SRHLDSDLNPLLVVGNCTLNLLSKEGKRQIPLNEQFLRKCPTADLKPEEILVSVNIPCSK
KWEFVSAFRQAQRPQNALAIVNSGMRVLFGEGDGIIRELSISYGGVGPTTICAKNSCQKL
TGRPWNEEMLDAACRLVLDEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPGPADKYESALEDLHSRHHWSTLKYQNVDAKQPPQDPIGHPIMHLSGIKHATGEAIYC
DDIPAVDPELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIVTEEHLQGVNSFCLLTKPE
KLLGTEEVFCVGQLVCAVIADSEVQAKQAAKRVKIVYQDLEPLILTIEEAIQHNSFFDQE
KKLEYGNVDEAFKVVDQILEGEIHIGGQEHFYMETQSILAVPKGEDQEMDIYVSTQFPKY
TQDIVASTLKLPANKVMCHVKRVGGAFGGKSIKTGILAAITAFAANKHSRAVRCILERGE
DMLITGGRHPYLGKYRAGFMNDGRILALDVEHYSNGGASLDESLLVIEMGLLKMENAYKF
PNLRCRGLVCRTNLPPNTALRGFGFPQAGFITEFCITEVAAKCGLSPEKVRSINMYKEID
QTPYKQEINAKNLILCWKECMAMSSYSLREVAVEKFNSENYWKKKGLAMVPLKFPVGLGS
VPMGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMLQVASRELRMPISKVHLRGTSTETV
PNTSISGASLVADLNGLAIKDACQTLLKRLEPIISKNPGGTWKEWAQAAYDESISLSATG
YFRGYESNMNWETGEGCPFKYFVYGAACTEVEIDCLTGAHKTIRTDIIMDAGCSINPALD
IGQIEGAFVQGMGLYTIEELNYSPQGVLYTRGPNQYKIPTICDIPTELHISLLPPSQNSN
TLYSSKGLGESALFLGCSVLFAIRDAVNAARRERGLVGQWKLSSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggacgcggcggccgagctgctcttctacgtgaacggccgccaggtaatagaaaaaaat
gttgatcctgaaacaatgctgttaccatacctgaggaagaaactccgactcacaggaact
aagtatggctgtggaagtggaggctgtggtgcctgcacagtgatggtatcacgatataac
cccattaccaagaagataagacattacccagccaatgcctgtctgactcccatctgttcc
ctgtatggcgctgcagtcaccacagtagaaggtataggaagcaccaaggccaggattcat
cctgttcaggagaggattgccaagtgtcatggcacacagtgtgggttctgcacccctggg
atggtgatgtccatctacacgctgctgaggaaccatctggagccctctctggatcagtta
accgatgcccttggtggtaacctgtgccgttgcactggatacaggcccatcatagatacc
tgcaagactttctgcacaacttctggctgctgtcaaagtaaagaaaatgggatttgttgt
ttggatcaaggaataaatgaattaccagaatttgaggaaggaaataagacaagcacaaaa
ctcttctcagaagaggagtttctgccactggatccaactcaggaattgatctttcctcca
gagctcatgataatggctgagaaacaaccacaaaggaccaggatttttggtggtgagaga
atgacatggatttctccagtgacactgaaggaactgatagaagctaaagccaagtatcct
caggcccctgttgtcatggggaacacttctgtggggcctgaaatgaaatttaaaggcatc
ttttacccagtcataatttctcctgatggaattgtagatctaactgttatgaactatgcc
tctaatgagctgaccttaggtgctggtctcagcctggctcaagtgaaggacatcctggct
gacctgatcctgaagctcccagaggagaagacacagatgtaccaggctctcttgaagcat
ctgagaactctagctggatcccagatcaggaacatggcttctttaggaggccacattgtg
agcaggcatctggattcagatctaaatcccctcctggttgtgggcaactgtaccctcaac
ttgctctcaaaagaaggcaaacgacagattcctttaaatgagcagtttctcagaaagtgc
cccactgcagatctaaaacctgaagaaatcttggtctcagtgaacatcccctgctcaaag
aagtgggaatttgtgtcagccttccgacaagcccagcggccacagaatgcacttgcaata
gtcaattccggaatgagagtcttgtttggagaaggggatggcatcattagagagttatcc
atctcgtatggaggtgttggtccaaccaccatctgtgcaaagaattcctgccagaaactc
actggaaggccctggaatgaagagatgctggatgcggcttgccggttggttttggatgaa
gtctctctcccaggctcggctcctggagggaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaagaagatggaccctgtg
cattatcctggccctgcagacaagtatgagagtgctttagaagatcttcattccagacat
cactggagtacattaaagtaccagaatgtagatgcaaagcagcctcctcaagacccaatt
ggccatcccatcatgcatctgtctggtattaagcatgccacgggtgaagccatctactgt
gatgacattcctgctgtggacccagaacttttcttgacttttgtaacaagttcaagagct
catgctaagattgtgtctattgatctatctgaagctctcagcctgccaggtgtggtagac
attgtaactgaggaacatcttcagggtgtaaactccttctgccttctaaccaaacctgag
aaacttctggggacagaagaggtattttgtgtgggtcagcttgtctgtgccgtgattgca
gattccgaggtccaggcaaagcaagctgccaagagagtgaagatcgtctatcaagatttg
gagccgctaatcctaacaattgaggaagcaatacaacacaactccttcttcgatcaagaa
aagaaactggaatatggaaatgttgatgaagcatttaaagtggttgaccaaattcttgaa
ggtgagatacatattggcggtcaagaacatttttatatggaaacccaaagcatccttgct
gttcccaaaggagaggatcaagagatggatatctatgtttccacacagtttcccaaatat
acacaggacatagttgcttcaaccttgaagctcccagctaacaaggtcatgtgtcatgtc
aagcgtgttggtggggcattcggggggaagtcaatcaaaaccgggatcctggcagccatc
acggcatttgccgcaaacaaacacagtcgagcagtccgctgcattctggaacgaggagaa
gacatgttaataactggaggccgccacccttacctaggaaagtacagagctggattcatg
aatgatggcagaatcctggccctggatgtggagcattatagcaatggaggggcctccctg
gatgagtcattacttgtgatagaaatgggacttctgaaaatggaaaatgcttacaagttt
cccaacctgcgttgccggggcttggtgtgcagaaccaaccttccacccaacacggctttg
cgtgggttcggcttccctcaagcagggttcatcactgaattctgtatcacagaagttgca
gccaaatgtggtttgtcccctgagaaggtccgaagcataaacatgtacaaggaaatcgat
caaacaccctacaaacaagagattaatgccaagaatctgattctgtgctggaaagaatgt
atggctatgtcttcctattccctgcgggaagtggccgtggaaaaattcaactcggagaat
tactggaagaagaaagggctggccatggtccccctgaagttccctgtcggccttggctcc
gtccctatgggtcaggctgctgccctggttcacatttatttagatgggtctgtgctggtg
actcatggtggaattgaaatggggcaaggggtccacactaaaatgcttcaggtggccagt
cgtgaattaaggatgccaatatctaaagttcacctgcgtggaacaagcacggagactgtc
cccaatacgagtatctctggagcttccttggtggcagatctcaatggcttggcaataaag
gatgcttgtcaaactcttctaaaacgccttgaacccatcatcagcaagaatcctggaggc
acttggaaggaatgggcgcaggctgcttacgatgaaagcatcagtctttcagctactggc
tacttcagaggttacgagtcgaatatgaactgggagacaggggaaggctgtcctttcaaa
tactttgtttatggagctgcctgtaccgaggttgaaatagactgcctgacaggtgctcat
aagactatcagaacagacattatcatggatgctggctgcagtataaatccagcccttgac
atcggccagattgaaggagcatttgttcaaggcatgggactttatacaatagaggagctg
aattattctcctcagggtgtcctatacactcgtggtccaaatcaatataaaatccctacc
atctgtgacatccccacagagctgcacatttctttgttgcctccatctcaaaactcaaat
accctgtattcatccaagggtctaggagagtctgcattattcctggggtgttcagtgctt
tttgccatccgtgacgctgtgaatgcagctcgacgggagagaggcctggtgggacagtgg
aagctcagtagtcccctcaccccagagaagattagaatggcgtgtgaagataagttcaca
aaaatgattccaagagatgaacctggatcctatgttccgtggaatgtacccatataa

KEGG   Manis javanica (Malayan pangolin): 108391580
Entry
108391580         CDS       T06054                                 

Definition
(RefSeq) aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00280  Valine, leucine and isoleucine degradation
mjv00350  Tyrosine metabolism
mjv00380  Tryptophan metabolism
mjv00750  Vitamin B6 metabolism
mjv00760  Nicotinate and nicotinamide metabolism
mjv00830  Retinol metabolism
mjv00982  Drug metabolism - cytochrome P450
mjv01100  Metabolic pathways
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108391580
   00350 Tyrosine metabolism
    108391580
   00380 Tryptophan metabolism
    108391580
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    108391580
   00760 Nicotinate and nicotinamide metabolism
    108391580
   00830 Retinol metabolism
    108391580
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    108391580
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391580
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     108391580
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Fer2_2 Ald_Xan_dh_C CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 108391580
NCBI-ProteinID: XP_017506712
LinkDB
Position
Unknown
AA seq 1336 aa
MMPSLPNSDELIFFVNGRKVIEKNADPEVNLLLYLRKVLHLTGTKYSCGGGGCGACTVMV
SRYNPKTKKIHHYPVTACLVPICSLYGAAITTVEGVGSIKTRIHPVQERLAKCHGTQCGF
CSPGMVMSIYTLLRNHPEPTPEQMTEALGGNLCRCTGYRPIVESGKTFCVQATVCHMKGS
GKCCMDQEERCLGKRQEKICTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFHG
ERTTWITPVTLKDLLEQKANFPKAPLVMGNTTLGPSIKFRDEFHPVFISPLGLPELSFVD
STEDGVTIGAGFSLAQLNDTLHSIVSEQPQEKTKTYRALLKHLRTLAGPQIRNMATLGGH
VVSRPNFSDLNPILAAGNATINLISKEGERQIPLDGLFLERSPEASLKPEEIVLSVYIPH
STQGHFVAGLRMAQRQESAFAIVNAGMSVRFEEGTDTIKGLQMFYGNVGPTVISASQTCQ
QLIGRQWDDQMLSDACRLVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLRVRRGLNKMD
PRMFPDIPEKFMSALEDFPIKTPQGIEMFQCVDPYQSPQDPVGHPVMHQSAIKHATGEAV
FIDDMPPIAQELFLAVVTSTRAHAKIISIDVAEALALPGVADVITAEDVPGDNTFQGEVF
YAQKEVICVGQIVCTVAADTYAHAKEAAKKVKIAYEDIEPRIITIEQALEHNSFLSVEKK
IEQGNVEQAFKSVDQIIEGVVHVEGQEHFYMETQTILAVPKKEDKEMVLHLGTQFPTYVQ
ESVAIALNVPRSRIACLMKRTGGAFGGKVTKPALLGAISAVAAHKTGHPIRFILERGNDM
LITAGRHPLLGRYKIGFMNNGVIKAADVEYYVNGGCTRDESEMVIEFLVLKSESAYCIPN
FRCRGRPCKTNLPSNTAFRGFGFPQATVVVEAYMTAVASQCNLLPEEVKEINMYKRTSKT
AYKQIFNPEPLRRCWKECLEKSSFYARKLAAEEFNKKNYWKKRGLAVIPMKYTIGFPMAY
YNQAAALVHIYLDGSVLVTHGGCEMGQGLYTKMIQVASRELNIPQSYIHLSETSTVTVPN
AVITAGSVGTDSNGKAVQNACQILMSRLQPIIRENPHGRWEEWIKKAFEESISLSATGYF
KGYQTHMDWKKEEGDPYPYFVYGAACSEVEIDCLTGAHKLLRTDIFMDSAFSINPALDIG
QVEGAFIQGMGFYTIEELKYSPEGVLYSRSPDEYKIPTVTEIPEKFHVTLMHSQNPVAIY
SSKGLGEAGVFLGSSVLFAIYDAVTAARRERGLTQTFPLSSPATPELIRMTCVDQFTGMI
PRDDPSTFIPWSLRVS
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgatgccctctctccccaactctgatgagctgattttttttgtgaatggaagaaaggtc
atagagaagaatgctgatcctgaagtaaatctactgctctacctgagaaaagtcctccat
ctcacaggcacaaagtacagctgtgggggaggaggctgtggagcctgcactgtcatggtg
tcaagatacaaccccaagaccaagaagatccaccattatccagttacagcgtgcctggtg
cccatctgctctctgtatggggctgccatcaccacagtggaaggtgtaggaagcatcaaa
actaggattcaccctgtgcaggagagactcgccaagtgtcatggcacacagtgtggcttc
tgcagcccagggatggtgatgtccatctacacgctgctgaggaaccacccggagcctacc
ccggagcagatgaccgaagctcttggaggtaatttgtgccgctgtactggataccgacca
attgtagaaagtggtaaaactttctgtgtgcaagcaactgtttgtcatatgaaaggatca
ggaaaatgttgcatggatcaagaagagaggtgtttggggaagagacaggaaaaaatatgt
accaaactgtataatgaagatgagttccagcccttggatccatcccaggagcctatattt
cctcctgaactgataagaatggcagaagatccaaacaagagaaggctgacattccatggg
gagaggactacctggatcacccctgtgaccctcaaagaccttctggagcagaaagccaat
ttccccaaagccccccttgtcatggggaacacgacactggggcccagtattaaattcaga
gatgaattccatccagtttttatatctccacttgggcttccagaactgtcttttgtggac
agcacagaggatggggtcacaattggtgcaggtttcagcctggcccagttgaacgatacc
ttacattctattgtttcggagcaaccgcaggagaagactaagacttaccgtgcactcctg
aagcatctgaggacgcttgccggaccccagattaggaatatggcgactttaggaggacat
gttgtgagcaggcccaatttttctgacctaaatcccattttagcagcaggaaatgctacc
atcaatctgatatctaaagaaggagaacggcagattcccttagacggccttttccttgaa
agatcgcctgaagccagccttaaaccggaagagattgtgttatctgtttatattccccac
tctacacaggggcacttcgtggcaggactccgtatggcccagcgacaagagagtgccttt
gctattgtcaatgccgggatgagtgtgaggtttgaagagggcacagatacaatcaagggc
cttcaaatgttctacgggaatgttggtcccaccgtcatctctgcaagccaaacctgccag
cagctcattgggagacaatgggatgaccaaatgctgagtgacgcctgccgattggtcctg
gatgagatttatattccaccagcagctgagggtggcatggtagaatacagacgaaccctc
atcatcagcttactcttcaaattctacctcagagtgaggcggggactgaataaaatggat
ccccggatgtttcccgatatcccagaaaagttcatgagtgctctggaagatttccccata
aaaacaccccaagggattgaaatgtttcagtgtgtggatccctaccagtccccacaagat
ccagttggccatccagtcatgcaccagtcagccattaaacacgccacaggggaagctgtg
tttattgacgacatgccccccatcgcccaagaactcttcctggctgtagtcaccagcacc
agagctcatgcaaagatcatatcaattgatgttgcagaagccctggcacttccaggtgtt
gctgatgtgataacagcagaggatgttcctggagataatacttttcaaggagaggttttc
tatgcccagaaagaggtaatttgtgtgggtcagattgtctgcaccgtggctgctgatacc
tatgctcatgcgaaagaggctgccaaaaaagtgaagatcgcttatgaagacatagaacca
aggatcatcacaatagagcaagccttagagcacaattcatttctttctgttgagaaaaaa
attgagcaaggaaatgtagagcaagcctttaaaagtgttgatcaaatcattgaaggtgtg
gtccacgtggaagggcaggaacatttttatatggaaacacaaactatcctggctgttcca
aaaaaagaagataaagaaatggtgttacaccttggaacacagtttccaacctatgtgcag
gaatctgtggctatagcattaaatgtcccaaggagtcgaatcgcctgcctcatgaaaaga
actggaggagcatttggggggaaagtgaccaagcctgctctgctaggtgcaatcagtgcc
gtggccgcccacaagactggccacccaatccggtttattctagagcgtggtaatgacatg
ctgataactgctggccgccacccactccttggacgatacaaaattggattcatgaacaat
ggtgtgatcaaagctgctgatgttgaatattatgtcaatggcggatgcactcgtgatgaa
tctgagatggtgatagagttcctggtgctgaaatctgaaagcgcatattgtattcctaat
ttccggtgccggggcaggccttgcaaaacaaatttgccatccaacactgcctttcgagga
tttggcttccctcaggctacagtggtagtcgaagcttacatgactgctgtggcatctcag
tgtaacttactccctgaagaggttaaagaaataaacatgtataaaagaactagcaaaaca
gcctataagcaaatatttaatccagagcccttgagaagatgctggaaagaatgtctggag
aaatcttcattctatgctaggaaattggctgctgaggaatttaacaaaaaaaattactgg
aaaaagagggggcttgctgtgattcccatgaaatacaccattgggttccccatggcctac
tacaatcaggctgctgctctggtccacatctatctggatggttctgtcttggtgactcat
ggtggctgtgaaatggggcaaggcctttacaccaaaatgattcaggtggccagtcgagaa
ctgaacatcccccagtcgtacatccacctgtctgaaacaagcacggtcacagtgcccaac
gcagtcatcactgcagggtcagtggggacggacagcaacggcaaggccgtgcagaatgcc
tgtcaaattcttatgtcccgtcttcagccaatcatcagggaaaaccctcatggaaggtgg
gaggaatggatcaaaaaagccttcgaagaatccatcagtctctcagctactggatatttc
aaaggctaccagacgcatatggactggaagaaggaggaaggtgacccttatccatatttt
gtttatggagcagcttgttctgaggttgaaatcgactgtctgactggggctcataagctc
cttaggactgacatcttcatggactctgctttcagcattaacccagccctggacattgga
caggttgaaggagcatttatccaaggcatgggcttctataccatagaagaactgaaatat
tccccagaaggtgtgctttattctcggagtccagatgagtacaaaatccccactgtcact
gagataccggaaaaatttcacgtcactttgatgcactcccaaaatcctgtagctatctac
tcatccaagggattgggtgaagctggagtattcttggggtcatccgtgttgtttgccata
tatgatgccgtgactgctgcccgcagagagagggggctaacccagaccttccccctgagt
agcccagcaactcctgagttgattcggatgacttgtgtggatcagtttactggaatgatt
cccagagatgatccttcaacatttataccttggtccctccgtgtgtcttaa

KEGG   Manis javanica (Malayan pangolin): 108391581
Entry
108391581         CDS       T06054                                 

Definition
(RefSeq) aldehyde oxidase 2 isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00280  Valine, leucine and isoleucine degradation
mjv00350  Tyrosine metabolism
mjv00380  Tryptophan metabolism
mjv00750  Vitamin B6 metabolism
mjv00760  Nicotinate and nicotinamide metabolism
mjv00830  Retinol metabolism
mjv00982  Drug metabolism - cytochrome P450
mjv01100  Metabolic pathways
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108391581
   00350 Tyrosine metabolism
    108391581
   00380 Tryptophan metabolism
    108391581
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    108391581
   00760 Nicotinate and nicotinamide metabolism
    108391581
   00830 Retinol metabolism
    108391581
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    108391581
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108391581
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     108391581
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 108391581
NCBI-ProteinID: XP_017506713
LinkDB
Position
Unknown
AA seq 1345 aa
MPCPSASDALVFFVNGRKVTERNAEPEVTLLTFLRKNLRLTGAKYACGRGGCGACTVMVS
KHDPASKKIRHFSVTACLVPICSLYGAAVTTVEGVGSLKTRIHPVQERIAKTHGTQCGFC
TPGMVMSMYTLLRNHLQPSEEQLMEALGGNLCRCTGYRPILASGRTFCVESNGCQQKGTG
KCCLDQEETDSSLLCGKSDICMELFAKEEFQPLDPTQDLIFPPELLRMAENPEKQTLTFH
GERVTWISPGTLKDLLELKAKHPEAPLIFGNTSLGPAMKSQGHFHPILLSPARISELSMV
SETSDGLTIGAGCSLAQVKDILAEMVSKLSEEKTQTYQALLKHLKSLAGQQIRNMASLGG
HIISRHCYSDLNPILAVGNTTLNVISEEGTRQIPLNQHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNTGMRVLFKEGTDTIEDLNIAYGGVGAATISAHTSC
RRLLGKHWNELMLDEACRLLLNEVSLPGWAPGGKVEFKRTLVVSFLFKFYLEVLQELKKL
LTLFTVPDSRHYPEISDGFLSAVEDFTVTVPQGVQRYQSVDSHQPLQDPVGRPIMHLSGI
KHATGEAVFCDDIPMVDRELSMALVTSTRAHAKIISIDSSEALDQPGVVDVITANDIPGT
NGAEDDRLLAVDEVLCVGQIICAVIAETDAQAKHAIEKIKITYEDLEPVIFTIEDAIKHN
SFLCPEKKLEQGNIEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVS
TQDPTHVQKTVSSSLDIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRL
VLDREDDMLITGGRHPLFGKYKVGFLNNGQIKALDIECFINGGCALDDSEQVTEFLTLKL
ENAYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEEIREKN
MYKTADKTIYKQVFNPENLIRCWNECLDKSSFQSRRMQVEEFNKKNYWKKRGIAIIPMKF
SVGFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMAYIHICE
TSTATVPNTVATGGSIGSDVNGRAVQNACQILLKRLEPIIKKNPEGTWENWVEAAFEQRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGSHKKIRTDIVMDACCS
LNPAIDIGQIEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPKQFNVSLLP
SSQTPLTIYSSKGLGESGMFLGSSVFFAITDAVAAARRERDIPEDFTATSPATPEWVRMA
CADRFTEMIPRDDPKTFKPWSIPIA
NT seq 4038 nt   +upstreamnt  +downstreamnt
atgccttgcccatcggcatcggacgcgttggttttctttgtgaatgggaggaaggtgacg
gagcggaatgcggaaccagaagtcaccctgctgaccttcctacgaaagaacttacgcctc
acaggagccaagtatgcctgcgggagaggaggctgcggggcctgcaccgtgatggtgtct
aagcatgatcccgcatccaagaagataagacacttctctgtcaccgcgtgcctggtaccc
atctgctctctgtatggagccgccgtcaccaccgtggaaggtgttggaagcctcaaaacc
aggattcaccctgtgcaggagaggatcgccaagacccatggcactcaatgtgggttctgc
actcctgggatggtgatgtccatgtacacgctgctcagaaaccacctgcagccctcagag
gagcagctcatggaagccctcgggggtaatctctgccgctgcacggggtaccggccaatc
ctcgcaagtggaaggaccttctgcgtggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcttggatcaggaagaaactgattcttccttactctgcgggaagagtgacatt
tgcatggagttatttgccaaagaggagttccagcccttggaccctactcaggacctcata
tttcccccagaactcttgagaatggcagagaacccagaaaaacaaaccctgacctttcat
ggagagagggttacctggatctcccctgggaccctcaaggatctcctggagctgaaagcg
aaacatcctgaagcccctcttatcttcggcaacacctccctgggacctgcaatgaaatct
caaggacattttcacccaattctcctctctcctgctaggatttctgagctgagtatggtg
tctgaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaggac
atcttagctgagatggtttccaagctctcagaggagaaaactcagacataccaagccctc
ctgaagcacctgaagagtctggcaggccagcagatccggaacatggcatccttagggggc
catattataagccggcattgctattcagatctgaatccaattctggcggtgggcaacact
accctcaatgtgatatcagaagaaggcacacggcagattcctctaaaccaacattttctt
gctgggttggcaagtgcagatcttaagccagaggagattttggaatctgtgtatatccct
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccagcaaaatgcc
ttggcagatgtgaacactggcatgcgagtcctcttcaaggagggcacggacaccatcgag
gacctgaacatcgcctatggaggcgttggagctgccacgatcagtgcacatacatcctgc
cggcggctcctagggaagcactggaacgagctgatgctggatgaggcttgcaggctgctt
ctaaatgaagtctccctccctggctgggctccaggtgggaaggtggaattcaagaggact
ctggtggtcagcttccttttcaaattctacctcgaagttctgcaggagctgaagaagctc
ctgacgctgttcactgtgcctgacagccgtcattaccctgaaatttcagatggattccta
agtgcagtagaagatttcacggtcacagtaccccagggagtccagaggtaccagagtgtg
gattctcaccagcccctccaagatccagttggacgtcccatcatgcacctgtcaggtatt
aaacatgccacaggtgaagctgtattttgtgatgacatccccatggtggacagagagctt
tctatggctttggtgaccagtaccagagcccatgcaaaaatcatatcaattgattcatct
gaggcccttgaccaacccggggtggttgatgtgataacagccaacgacattccaggcacc
aatggtgctgaagacgacagactgctggctgtagatgaggtactttgtgtgggccagatc
atctgtgctgtgattgcagagacagatgcacaggcaaagcatgcaattgaaaagataaag
atcacctatgaagatctggagcccgtaatcttcaccatcgaggatgccataaaacacaac
tcattcctgtgccctgaaaaaaaacttgaacaaggaaacattgaggaggcatttgaaaaa
gttgaccaaattgttgaaggagaggtccacgttggaggacaggaacatttttacatggaa
acacaaagagtgcttgttattcctaagacagaggacaaagaactggacatttatgtgtcg
acacaggatccaacgcatgtgcagaaaacagtgtcctcttctttagacatccccatcaac
aggatcacctgtcatgtgaaaagagtgggtgggggctttggcgggaaggtaggaagacca
gctgtattcggggctatagcagctgtgggcgccatcaaaactggtcaccccattcgtctt
gttcttgatcgtgaagatgatatgctaataactgggggaaggcatccattatttggaaaa
tataaagtgggattcttgaacaacgggcaaatcaaagctctagacattgagtgcttcatt
aatggaggatgtgccctggatgactctgaacaggtaacagagtttcttacactgaagctg
gaaaatgcatataagatccgcaacctcaggttccggggccgtgcgtgcatgacaaattta
ccatccaatacagcctttcgaggatttggctttccacagggaaccctcataacagaatct
tgcatcacagctgtggcagccaaatgtggccttctgccagaagagataagggagaaaaat
atgtacaaaacagctgataaaaccatctacaaacaagtgttcaaccctgagaacctaata
aggtgttggaacgaatgtctggataagtcttcctttcagagcagaagaatgcaagtggaa
gagttcaataagaagaattactggaagaagagaggcattgctattatccccatgaagttt
tcagttggctttgctgcaacaagctatcatcaggcagctgcacttgttcacatctacaca
gacgggtctgtattggtcacacatggaggcaacgaactgggacaaggtatccacaccaaa
atgctgcaggtggccagccgtgaattaaaaatacccatggcttatatacacatctgtgaa
acaagtacagccacagtgcctaacacagttgccacaggaggctccatcggttcagacgtc
aatggcagagctgtgcagaatgcctgtcagatcctgctgaaacgccttgaacccatcatt
aagaaaaatccagaaggtacctgggaaaactgggtagaagccgcttttgaacagagaatc
agcctttcagccactggatacttcaggggttacaaggccttcatggactgggagaaagga
gaaggagacccttttccatactatgtctatggagcagcctgttcagaggttgaaattgac
tgcctgacaggatctcacaagaaaatcagaacggacatcgtcatggatgcatgttgcagc
ctaaatcctgccattgatattgggcagattgaaggttcattcattcagggaatgggcctt
tatacaactgaagagctgaaatattctccagaaggtgtcctgtactctcgaggcccagat
gagtacaaaattccaaccatcactgacgtcccaaagcagttcaatgtctccctcttgcct
tcatcacaaactccactaaccatctattcatccaagggcctgggggagtctggaatgttc
ctggggtcatctgtgttctttgccatcactgatgctgtggccgcagcacgacgagaaaga
gacatacctgaggacttcacagcaacaagcccagcaacaccagagtgggttcgaatggcc
tgtgcagatcggttcacagagatgatcccaagagatgaccctaagacatttaaaccttgg
tctatccctatagcataa

DBGET integrated database retrieval system