KEGG   Manis javanica (Malayan pangolin): 108391616
Entry
108391616         CDS       T06054                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04012  ErbB signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04151  PI3K-Akt signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04934  Cushing syndrome
mjv05162  Measles
mjv05165  Human papillomavirus infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05206  MicroRNAs in cancer
mjv05215  Prostate cancer
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108391616 (CDKN1B)
   04066 HIF-1 signaling pathway
    108391616 (CDKN1B)
   04068 FoxO signaling pathway
    108391616 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    108391616 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108391616 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108391616 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    108391616 (CDKN1B)
   05206 MicroRNAs in cancer
    108391616 (CDKN1B)
   05203 Viral carcinogenesis
    108391616 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    108391616 (CDKN1B)
   05220 Chronic myeloid leukemia
    108391616 (CDKN1B)
   05215 Prostate cancer
    108391616 (CDKN1B)
   05222 Small cell lung cancer
    108391616 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108391616 (CDKN1B)
   04934 Cushing syndrome
    108391616 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    108391616 (CDKN1B)
   05169 Epstein-Barr virus infection
    108391616 (CDKN1B)
   05165 Human papillomavirus infection
    108391616 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108391616 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108391616
NCBI-ProteinID: XP_017506771
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQDVSANRPTVPLIG
SQANSEDSHLVDPKTDTSDNQTGLAEQCAGMRKRPAADDSSPQNKRANRTEENVSDGSPN
AGAVEQTPKKPGLRRRQM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgtcagcgcgaaccgcccgacggtgcctttaattggg
tctcaggcgaactcagaggactcccatttggtagacccaaagactgatacctcggacaac
cagacggggctggcggagcagtgcgctgggatgaggaagagacccgcggcggacgattcc
tctccccaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaat
gcgggcgcagtggagcagacgcccaagaagccgggcctccgaagacgtcaaatgtaa

DBGET integrated database retrieval system