KEGG   Manis javanica (Malayan pangolin): 108391841
Entry
108391841         CDS       T06054                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00220  Arginine biosynthesis
mjv00330  Arginine and proline metabolism
mjv01100  Metabolic pathways
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04370  VEGF signaling pathway
mjv04371  Apelin signaling pathway
mjv04611  Platelet activation
mjv04915  Estrogen signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04931  Insulin resistance
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108391841 (NOS3)
   00330 Arginine and proline metabolism
    108391841 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108391841 (NOS3)
   04371 Apelin signaling pathway
    108391841 (NOS3)
   04066 HIF-1 signaling pathway
    108391841 (NOS3)
   04020 Calcium signaling pathway
    108391841 (NOS3)
   04071 Sphingolipid signaling pathway
    108391841 (NOS3)
   04022 cGMP-PKG signaling pathway
    108391841 (NOS3)
   04151 PI3K-Akt signaling pathway
    108391841 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108391841 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108391841 (NOS3)
   04921 Oxytocin signaling pathway
    108391841 (NOS3)
   04926 Relaxin signaling pathway
    108391841 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108391841 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108391841 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108391841 (NOS3)
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108391841 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DEC-1_N
Other DBs
NCBI-GeneID: 108391841
NCBI-ProteinID: XP_017507163
LinkDB
Position
Unknown
AA seq 1050 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPAPQPALDHSPPLTRAP
EGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPSQAPPPAEQL
LSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVVATGTYQLRESELVFGAKQAWRNAPR
CVGRIQWGKLQVFDARDCSSAQEMFTYICSHVKYATNRGNLRSAITVFPQRSPGRGDFRI
WNSQLVRYAGYRQQDGSVRGDPANVEITELCVQHGWTPGNGRFDVLPLLIQAPDEPPELF
ALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIG
TRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHAA
TASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPTFRYQPDPWKGN
AVKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFR
KAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRP
EQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAF
ARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAARDI
FSPRRSWKRQRYRLSAQAEGLQLLPGLTHVHRRKIFQATVLSVENLQSSKSTRATILVRL
NTGGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPGGPPPN
WVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPSEQQELETLSQDPRRYEEW
KWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHITVAVLAYR
TQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRG
FWQERLHDIDSKGEAGSQGNDWGAGGSHII
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggtcaggagcctgggccgccctgcggcctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagcctccccagcacctgagcccagccgg
gcaccagcacctgcaccccagcctgcactagaccacagccccccgctcacccgggcccca
gaggggcccaagttcccccgtgtgaagaactgggaggtgggcagcatcacctacgacacc
ctgagcgcccaggcacagcaggatgggccctgcaccccacgacgctgcctgggctcccta
gtatttccacggaaactgcagagccggccctcccaggcccctccacctgctgagcagctg
ctgagccaggccagggacttcatcaaccagtactacagctccatcaagcggagtggttcc
caggcccatgagcaacggcttcaggaggtggaagctgaggtggtggccacaggcacctac
cagcttcgggagagtgagctggtgttcggggccaagcaggcctggcgcaacgctccacgc
tgtgtgggtcggatccagtgggggaagctgcaggtgttcgatgcccgggattgcagctct
gcgcaggaaatgttcacctacatctgcagtcacgtcaagtacgccaccaaccggggaaac
cttcgctcggccatcacagtgttcccccagcgcagccccggccgtggggacttccgaatc
tggaacagccaactggtgcgctacgcgggctaccggcagcaggacggctccgtgcggggg
gacccggccaacgtggagatcaccgagctctgcgtccagcatggctggacccccggaaac
ggccgcttcgatgtactgcccctgctgatccaggccccagatgagcccccagaactcttt
gccctgccccctgagctggtcctcgaggtgcccttggagcaccccacgctggagtggttc
gcagccctgggcctgcgctggtatgccctcccagcggtgtccaacatgcttctggaaatt
gggggcttagagttccctgcagcccctttcagtggctggtacatgagcactgagatcggc
acgcggaacctgtgtgaccctcaccgctacaacatcctggaggatgtggccgtctgcatg
gacctggatacccggacgacctcttccctgtggaaagacaaggcagcagtggaaatcaac
ttggctgtcctgcacagttaccagctggccaaagtgaccattgtggatcaccatgctgcc
acagcctcctttatgaagcacctggagaatgagcagaaggcgagggggggctgccctgct
gactgggcctggatcgtgccccccatctcgggcagcctcacccccgtcttccatcaagag
atggtcaactatatcctgtcccctacattccgctaccagccagacccctggaaggggaat
gcagtcaagggtgccggcatcaccaggaaaaagacctttaaggaggtggccaatgcagtg
aagatctctgcctcactcatgggcaccgtgatggcaaagcgagtgaaggcaacgatcctg
tatggctccgagaccggcagggcccagagctacgcacagcagctggggaggctcttccgg
aaggctttcgacccccgggtcctgtgcatggatgagtatgacgtggtgtccctcgagcat
gagacgctggtgttggtggtgaccagcacatttgggaatggggatcccccagagaatgga
gagagttttgcagcggccctgatggagatgtcaggcccctacaacagctcccctcggcca
gaacagcacaagagttacaaaatccgcttcaacagcgtctcctgctcagacccactggtg
tcctcctggcggcggaagaggaaggagtccagtaacacagacagcgcaggggcactgggc
accctcaggttctgtgtgttcggcctgggctcccgggcatacccccacttctgcgccttt
gctcgggcggtggacacacggctggaagagctgggcggggagcggctgctgcagctgggc
cagggtgacgagctgtgtggccaggaggaggccttccgcggctgggcccaggccgccttc
caggcctcctgtgaaactttctgtgtgggcgaagatgccaaggctgccgcccgggacatc
ttcagccccagacggagctggaagcgccagaggtaccggctgagtgcccaggctgaaggc
ctccagctgctgccaggcctgacccatgtgcataggaggaagatattccaggctacagtc
ctctccgtggaaaacctgcagagcagcaagtccactcgagccacgattctggtgcgcctg
aacactggaggccaagaggggctccagtaccagccaggggaccacataggcatctgcccg
cccaaccggccaggcctcgtggaggcactgctgagccgcgtggaggatccacctccacca
ggagagcccgtggcagtggaacagctggagaagggcagccctggtggccctccccccaac
tgggtacgggacccccggctgcccccatgcacactgcgccaggctctcaccttcttcctg
gacatcacttccccgcccagccctcaactccttcgactgctcagcaccctggccgaagag
cccagtgaacagcaggagctggagaccctcagtcaggacccccggcgctatgaggagtgg
aagtggttccgctgccccacgctgctggaagtactggagcagtttccgtcggtggcgctc
cctgctcccctgctcctcacccagctgcccctgctccagccccggtactactctgtcagc
tcagcacccagcgcccacccaggagagatccacatcacagtagctgtgctggcatacaga
acccaggatgggctgggccccctgcactatggagtctgctctacatggctaagccaactc
aagacaggagaccctgtaccctgcttcatccgaggggctccctccttccggctgccgcct
gatcccagcttgccctgcatcctcgtgggccccggtactggcatcgccccctttcgggga
ttttggcaggagcggctgcatgacattgacagcaaaggtgaggctgggagccaagggaat
gactggggggcaggagggagtcacataatctag

DBGET integrated database retrieval system