KEGG   Manis javanica (Malayan pangolin): 108391910
Entry
108391910         CDS       T06054                                 

Gene name
ACVR2A
Definition
(RefSeq) activin receptor type-2A isoform X1
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108391910 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108391910 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108391910 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108391910 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108391910 (ACVR2A)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108391910 (ACVR2A)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108391910 (ACVR2A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH Dynein_IC2
Other DBs
NCBI-GeneID: 108391910
NCBI-ProteinID: XP_017507288
LinkDB
Position
Unknown
AA seq 521 aa
MGAAAKLAFAVFLISCSSGAILGRSETQECIFYNANWERDRTNRTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGSMCNERFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVVCAFWVYRHHKMAYPPVLVPTQHAFH
IMIEDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLSEYVAVKIFPIQDKQSWQNE
YEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHI
AETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKS
AGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYM
LPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSA
GCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcttgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtattttctataatgctaattgggaaagagat
agaactaatcgaactggtgttgaaccctgttacggtgataaagataaacggagacattgc
tttgctacttggaagaatatttctggctccattgaaatagtgaaacaaggttgttggctg
gatgatatcaactgttatgacaggactgattgtatagaaaaaaaggacagccctgaagta
tatttttgttgctgtgagggcagtatgtgtaatgaaaggttttcttactttccagagatg
gaagtcacacagcctacttcaaatccagttacacctaaaccaccctattacaacatcttg
ctctattccttggtgccgcttatgttaattgcaggcattgtcgtttgtgcattttgggta
tacaggcatcataaaatggcctaccctcctgtacttgttccaactcaacacgcctttcat
ataatgatagaggaccctggaccacccccaccttctccattactaggtttgaaaccactg
cagttactagaagtgaaagcacgggggagatttggttgtgtctggaaagcccagttgctc
agtgaatatgtagctgtgaaaatatttccaatacaggacaaacagtcttggcaaaatgag
tatgaagtctatagtttgcctggaatgaagcatgagaacatattacagttcattggtgca
gaaaaacgtggcaccagtgttgatgtggatctttggctaatcacagcatttcatgaaaag
ggttcactgtcagactttcttaaggctaatgtggtctcttggaatgaattgtgtcatatt
gcagaaaccatggctagaggattggcatatttacatgaggatatacctggcctaaaagat
ggccacaaacctgccatatctcacagggacatcaaaagtaaaaacgtgctgttgaaaaac
aatctgacagcttgcattgctgactttgggttggcgttaaagtttgaggctggcaagtct
gcaggcgatacccatggacaggttggtacccggaggtatatggctccagaggtattagag
ggtgctatcaacttccaaagggatgcgttcttgaggatagatatgtatgccatgggatta
gtcctgtgggaactggcctctcgctgtactgctgcagatggacctgtagatgagtacatg
ttgccatttgaggaggaaattggccagcatccatctcttgaagacatgcaggaagttgtt
gtgcataaaaaaaagaggcctgttttaagagattattggcagaaacatgctggaatggca
atgctctgtgaaacgatagaagaatgttgggatcacgatgcagaagccaggttatcagct
ggatgtgtaggtgaaagaattactcagatgcagagactaacaaatatcattaccacagag
gacattgtaacagtggtcacaatggtgacaaatgttgactttcctcccaaagaatctagt
ctatga

DBGET integrated database retrieval system