KEGG   Manis javanica (Malayan pangolin): 108392197
Entry
108392197         CDS       T06054                                 

Gene name
TOP2A
Definition
(RefSeq) DNA topoisomerase 2-alpha isoform X1
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108392197 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mjv03032]
    108392197 (TOP2A)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108392197 (TOP2A)
Enzymes [BR:mjv01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     108392197 (TOP2A)
DNA replication proteins [BR:mjv03032]
 Eukaryotic type
  DNA Topoisomerases
   108392197 (TOP2A)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    108392197 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108392197 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim Filaggrin
Other DBs
NCBI-GeneID: 108392197
NCBI-ProteinID: XP_017507778
LinkDB
Position
Unknown
AA seq 1532 aa
MEVSPLQPVNENMQINKTKKNEDSKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREITFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGKAGQMELKPFNGEDYTCITFHPDLSKFKMQSLDKDIVALML
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKIIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKTHQVKNHM
WIFVNALIENPTFDSQTKENMTLQVKNFGSTCQLSEKFIKAATGCGIVESVLNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKMLNVREASHKQIMENAEINSIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRVQFKYSGPEDDAAISLAFSKKHTDD
RKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLTRLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLVNGAEGIGTGWSCKIPNFDVREVVNNIRCLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVRFVVKMTEEKLAEAERAGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENQDSDNEKETERSDSVTDSGPTFNYLLEMPLWYLTKEK
KDELCKLRNEKEQELETLKRKSPSDLWKEDLAAFIEELEAVEAKEKQDEQVGLPRKGGKG
KGKKTQMAEVLPSPCGKRVIPQVTVEMKAEAEKKIKKRIKNENNEGGSQEDGMEVEGLKQ
RLEKKPKREPGTKTKKQTTLPFKPVKKGKKRNPWSDSESDMSSNESNFDVPPRETEPRRA
KAKTKFTVELDSDEDFSDFDEKDQDEDFVPSDASPPKTKTSPKHSNKELKPQKSATSEEL
EVAGLGADDAGVDPADSPAARFPAETKTLNPVSKKDVKKTAAKSQSSTSTAGVKKRAAPK
GTKKDLGLNSDTSQKPDPPKAKNRRKRKPSTSDDSDSNFEKMISKAAANKKSKGESDDLH
LDLNSALAPRAKSGRAKKPIKYLEESDEDDLF
NT seq 4599 nt   +upstreamnt  +downstreamnt
atggaggtgtcaccactgcagcctgtgaatgaaaatatgcaaatcaacaaaacaaagaaa
aatgaagattctaagaaaagactgtctattgaaagaatctatcaaaagaaaacacaactg
gaacatattttgctccgcccagatacctacattggctctgtggaattagtgacccagcaa
atgtgggtttatgatgaagatgttggcattaactatagagaaatcacatttgttcctggt
ttgtacaaaatctttgatgagattctagtaaatgctgcagacaacaaacaaagggaccca
aaaatgtcttgtattagagtcacaattgacccggaaaacaatttaattagtatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgagaaggtgtacgtcccagccctc
atctttggacagctcctaacttctagtaactatgatgatgatgaaaagaaagtaacaggt
ggtcgaaatggttacggagccaaattgtgtaacatattcagtaccaaatttactgtggaa
actgctagtagagaatacaagaaaatgttcaaacagacatggatggataacatggggaaa
gctggtcagatggaactcaagccctttaatggggaagattatacatgtattaccttccac
cctgatttatctaagtttaaaatgcagagcctagacaaagatattgttgcactgatgctc
agaagagcgtatgatattgctggatccactaaagatgtcaaagtctttctcaatggaaat
aagctgccagtaaagggattccgtagttatgtagatatgtatttgaaggacaaggtagat
gaaactggcaatccattgaaaattatccatgaacaagtaaaccacagatgggaagtatgt
ttaaccatgagtgaaaaaggcttccagcaaatcagctttgtcaatagcattgctacttcc
aagggtggcagacatgttgactatgtagctgatcagattgtgactaaacttgttgatgtt
gtgaagaagaagaacaagggtggtgttgcagtaaaaacacatcaggtgaaaaatcacatg
tggatttttgtgaacgccttaattgaaaacccaacctttgactctcaaacaaaagaaaac
atgactttacaagtcaagaactttggatcaacatgccaattaagtgaaaaattcattaaa
gctgcaactggctgtggtattgtagaaagcgttctgaactgggtgaagtttaaggcccaa
gtccaattaaacaagaaatgttcagctgttaaacataacagaatcaagggaattccaaaa
cttgatgatgctaatgatgcagggggccgaaactccactgagtgtactcttatcctaact
gagggagactcagctaaaactttggctgtttcaggccttggtgtggtcgggagagacaaa
tacggggtttttcctctcagaggaaaaatgctcaatgttcgagaagcttctcataaacag
ataatggaaaatgctgaaattaacagtatcatcaaaattgtgggtcttcagtacaagaaa
aactatgaagacgaagattcgttgaagactcttcgttatgggaaaataatgattatgaca
gatcaggatcaagacggttcccatatcaaaggcttgctgataaattttattcatcacaac
tggccctctcttctgcgacatcgttttctagaggaatttatcactcccattgtaaaggtg
tctaaaaataagcaagaaatggcattctatagccttcctgaatttgaagaatggaagagt
tctactccaaatcataaaaaatggaaagtcaagtattacaaaggtctgggcactagcact
tcgaaagaagccaaagaatactttgcagatatgaaaagacatcgtgtccaattcaaatat
tctggtcccgaagatgatgctgcaatcagcctggcctttagcaaaaagcatacagatgat
cgaaaggaatggttaactcatttcatggaggatagaaggcaacggaaattacttggcctt
cctgaggattacttatatggacaaactactacgtatctcacatacaatgacttcattaac
aaggaacttatcctgttctcaaattctgataatgagagatctatcccatctatggtggat
ggtttgaaaccaggtcagagaaaggttttatttacatgtttcaaacggaatgacaagcga
gaggtgaaggttgcccagttagctgggtcagtggctgagatgtcctcatatcatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ctgaacctcttgcagcccattggtcagtttggtaccaggctgcatggtggcaaggattct
gctagtcctcgatacatcttcacaatgctcagccctttgactcggttgttatttccacca
aaagatgatcacacattaaaattcttatacgatgacaaccaacgtgttgagcctgaatgg
tacattcctattatacccatggtgctcgtaaatggtgctgaaggaatcggtactgggtgg
tcttgcaaaatccccaattttgatgttcgtgaagttgtgaataacatcaggtgtttgatg
gatggagaagaacctttgccaatgcttccaagttacaagaatttcaagggtactattgaa
gagctggctccaaatcaatatgtgattagtggtgaagttgccattctcaattccacaacc
attgaaatctcagagctgcccatcagaacatggactcagacatacaaagagcaggtcctg
gaacccatgctgaatggcactgagaagacgccgccactcatcacagattacagggagtac
cacacagacaccaccgtgaggttcgtcgtgaagatgaccgaagaaaagctggcagaggca
gagagagctggactacacaaagtcttcaaactccagactagtctcacatgcaactctatg
gtgctttttgaccatgtaggttgtttaaagaaatatgacacggtgttggatattctaaga
gatttctttgaactcaggcttaaatattatggattaagaaaagaatggcttctaggaatg
cttggtgccgaatctgctaaactgaataatcaggctcgctttatcctagagaaaatagat
ggcaaaataatcattgaaaataagcctaagaaggagttaattaaagttctgattcagagg
ggatatgattcagatcctgtgaaggcttggaaagaagcccagcaaaaggttccggatgaa
gaagaaaatcaagacagtgacaatgagaaggaaactgaaaggagtgactctgtaacagat
tctggaccaaccttcaactacctccttgaaatgcctctctggtatctcaccaaggaaaag
aaagatgagctgtgcaaactaagaaatgagaaagagcaagagctagaaacattaaagaga
aagagtccatcagatttgtggaaagaagacttggctgcttttattgaggagctggaggct
gttgaagcaaaggagaaacaagatgaacaagtaggacttcctaggaaaggggggaaagga
aaggggaagaaaacacaaatggctgaagtgttgccttctccatgtggaaaaagagtcatc
ccccaagtgacagtagagatgaaagcagaggcagaaaagaaaattaaaaagagaattaag
aatgaaaataatgaaggaggctcacaagaggatggtatggaagtagaaggcctgaaacaa
agattagaaaagaaaccgaaaagagaaccaggtaccaagacaaagaaacaaactacattg
ccatttaaaccagtcaaaaaaggaaagaagagaaacccctggtctgattcagaatcagat
atgagcagtaatgaaagtaattttgatgtgcctccacgagaaacagagcctcggagagca
aaagcaaaaaccaaattcacagtggagttggattcagatgaagatttctcagattttgat
gaaaaagatcaagatgaagattttgtcccatcagatgctagtccacctaagaccaaaact
tccccaaaacatagcaacaaagaactgaagccgcagaaaagtgccacatcagaagaactg
gaagtagcaggccttggtgcagatgatgctggggtcgatcccgcagactctcctgccgcc
cgtttcccagctgaaactaaaactttaaaccctgtttctaaaaaggatgtgaagaagaca
gcagcaaaaagtcagtcttccacctccactgcaggtgtgaagaaacgggctgcaccaaaa
ggaaccaagaaggatctgggcttaaattctgatacctctcaaaagcctgatcctcccaaa
gccaagaatcgccgcaaaaggaagccatccacttctgatgattctgactctaattttgag
aaaatgatttctaaagcagccgcaaacaagaaatccaagggagagagtgatgacctccat
ctggacctaaactcagctttggctcctcgggcaaaatctggacgggcaaagaaacctata
aagtacctcgaagaatcagatgaagatgatctgttttaa

KEGG   Manis javanica (Malayan pangolin): 108408797
Entry
108408797         CDS       T06054                                 

Gene name
TOP2B
Definition
(RefSeq) DNA topoisomerase 2-beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108408797 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mjv03032]
    108408797 (TOP2B)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108408797 (TOP2B)
Enzymes [BR:mjv01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     108408797 (TOP2B)
DNA replication proteins [BR:mjv03032]
 Eukaryotic type
  DNA Topoisomerases
   108408797 (TOP2B)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    108408797 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108408797 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 108408797
NCBI-ProteinID: XP_017534539
LinkDB
Position
Unknown
AA seq 1734 aa
PADLPIICELLMSKTVTKQDWAWNFAIGREVAAKRPRLDDEVLTDSGGGRRALPPLRLPW
CANVCVWCYAGQEEGGDRGGGGSGYCPSRCVDVRRSGLQRGCRRRPLRQRHRRRRLPQSQ
WPALAECGHEMMLMTLFDQNNAAKKEELETANKNDSSKKLSVERVYQKKTQLEHILLRPD
TYIGSVEPLTQLMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVC
IDPESNIVSIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAK
LCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKM
EKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKV
IHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAG
VSVKPFQVKNHMWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIV
ESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSL
AVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESL
KTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELS
FYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAA
ITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSN
SDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTI
VNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKF
LYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPM
LPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTD
KTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGC
LKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENR
SKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEETQNQHDDSSSDSGTPSGPDFNYILNM
SLWSLTKEKVEELIKQRDAKGREVCDLKRKSPSDLWKEDLAAFVEELEKVEAQEREDVLA
GMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVPEITAMKADASKKLLKKKKSDLDTTT
VKIEFDEEFSGIPVEGTGEEALVPSAPINKVPKPKREKKEPGTRVRKTPTSSGKSSTKKV
KKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDNN
DLEELKVKASPITNDGEDEYVPSDGLDKDEYAFSPSKSKAAPEKSSHDKKSQDFGNLFSF
PSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPRRA
PKQKKVETINSDSDSEFGIPKKTPTPKGKGRGAKKRKASGSENEGDYNPGRKTSKTTSKK
PKKTSFDQDSDVDIFPSDFTSEPPSLPRTGRARKEVKYFAESDEEEDVDFAMFN
NT seq 5207 nt   +upstreamnt  +downstreamnt
agccagccgacctgccaatcatctgcgagctgctcatgagcaagaccgtcactaaacaag
attgggcttggaattttgcgattgggcgggaggttgcggcgaaaaggccccgattggatg
acgaggtgctgactgacagtgggggtggccgccgcgccctccccccactccgccttccct
ggtgcgcgaatgtgtgtgtgtggtgttatgccggacaagaagagggaggcgaccgcggcg
gcggcggctctggttattgtccctctcggtgtgtggatgtgaggaggtcggggctgcagc
gcggctgtcgaaggcggcctttgaggcagcggcaccggcggcggaggctcccgcaatccc
agtggccggctttggcggagtgcgggcatgagatgatgcttatgactctttttgatcaga
acaatgctgcaaaaaaggaggagttagaaactgcaaacaaaaatgattcttcaaagaaat
tgtctgttgagagagtttatcagaagaagacacaacttgaacatattctccttcgtcctg
acacatacattgggtcagtggagccgttgacacagctaatgtgggtgtatgatgaagatg
tgggaatgaattgcagagaggttacctttgtgccagggttatacaagatctttgatgaaa
ttttggttaatgcagctgacaataaacaaagagataagaacatgacgtgtattaaagttt
gtatcgatcctgaatctaacattgtaagcatttggaataatgggaaaggcattccagtag
tagagcacaaagtagagaaagtttatgttcctgcattaatttttggacagcttttaacat
ccagtaactatgatgatgatgagaaaaaagtaacaggtggtcgcaatggttatggtgcaa
aactttgtaatattttcagtacaaagtttacagtagaaactgcttgcaaagaatacaaac
atagttttaagcagacatggatgaataatatgatgaagacttctgaagccaaaattaaac
attttgatggtgaagattacacatgcataacattccaaccagatttgtccaaatttaaga
tggaaaaactcgacaaggatatcgtggctctcatgaccagaagagcttatgatttggctg
gttcatgcaaaggggtcaaggtcatgtttaatggaaagaagttgcctgtaaatggatttc
gcagttatgtagatctttatgtgaaggacaaattggatgaaactggagtggctctgaaag
tcattcatgaacttgcaaatgaaagatgggatgtttgtctcacattgagcgaaaaggggt
tccagcaaatcagctttgtaaatagtattgcaacaacaaaaggtggacggcatgtggatt
atgtagtagatcaagttgttggtaaactgattgaagtagttaagaaaaagaataaagctg
gtgtatcagtgaaaccatttcaagtaaaaaaccatatgtgggtttttattaattgcctta
ttgaaaatccaactttcgactctcagactaaggaaaacatgactctgcagcccaaaagtt
ttgggtccaaatgtcaactgtcagaaaaattttttaaagcagcctctaactgtggcattg
tagaaagtatcctgaactgggtgaaatttaaggctcaaactcagctgaacaagaagtgtt
cgtcagtaaagtacagtaaaatcaaaggtattcccaaactggatgatgctaatgatgctg
gtggcaaacattccctggagtgtacactgatactaacagagggagactctgccaaatcgc
tggctgtgtctggattaggtgtgattggacgagacagatatggagtctttccactcaggg
gaaaaattcttaatgtacgggaagcttctcataaacagatcatggaaaatgcagaaataa
ataatattatcaaaatagttggtctacaatacaagaaaagttatgatgatgcagaatctc
tgaaaactttacgctatggaaagattatgattatgactgatcaggatcaagatggttctc
acataaaaggcctgcttattaatttcatccatcacaactggccatcacttttgaagcatg
gttttcttgaagagttcattactcctattgtaaaggcgagcaaaaataagcaggaacttt
ccttctacagtattcctgaatttgatgagtggaaaaaacatatagaaaaccagaaagcat
ggaaaataaagtactacaaagggttgggtaccagtacagctaaagaagcaaaggaatatt
ttgctgatatggaaaggcatcgcatcttgtttagatatgctggtcctgaagatgatgctg
ccattaccttggcattcagtaagaagaagattgatgacagaaaagaatggttaacaaatt
ttatggaagatcggagacagcgtaggttacatggcttaccagagcaatttttatatggta
cagcaacaaagcatttgacttacaatgatttcatcaacaaggaattgattctgttctcaa
actcagacaatgaaagatctataccatctcttgttgatggctttaaaccaggccaacgaa
aagttttatttacttgtttcaagaggaatgataaacgtgaagtaaaagttgcccagttgg
ctggatctgttgctgagatgtctgcttatcatcatggagaacaagcattaatgatgacta
ttgtgaatttggctcagaacttcgtgggaagtaacaatattaacttgcttcagcctattg
gtcagtttggaactcggcttcatggtggcaaagatgctgccagccctcgctatattttca
caatgttaagctctttagcaagactgctttttcctgcggtggatgacaacctgcttaaat
tcctttatgatgataatcaacgtgtagagcctgagtggtatattcccataattcccatgg
ttttaataaatggtgctgagggcattggtactggatgggcttgtaaactacccaactatg
atgctagggaaattgtgaacaatgtcagacgaatgctagatggcctggatcctcatccca
tgcttccaaactataaaaactttaaagggacaatccaagaacttggtcaaaaccagtatg
cagtcagtggtgaaatatttgtggtggatagaaacacagtagagattacagagcttccag
ttagaacctggacacaggtatacaaagagcaggttttagaacctatgctaaatggaacag
ataaaacaccagcattgatttctgattataaggaatatcatactgatacaactgtgaaat
ttgtggtgaaaatgactgaagagaaactagcacaagcagaagctgctggattacataaag
tttttaaacttcaaacaacgcttacttgtaattccatggtactctttgatcatatgggat
gtctaaagaagtatgaaaccgtacaagacattttgaaagaattctttgatttacgattaa
gttattatggtttacgtaaggagtggctagtaggaatgttgggagcagaatctacaaagc
ttaacaatcaagcccgttttattttagagaagatacaaggaaaaattactatagagaata
ggtcaaagaaagatttgattcaaatgttagtccagagaggttatgaatctgacccagtga
aagcctggaaagaagcacaagaaaaggcagcagaagaggaagaaactcaaaaccagcatg
atgatagttcctctgattcaggaactccttcaggccccgattttaattatattttaaata
tgtctctgtggtctcttactaaagaaaaagttgaagaactgattaaacagagagatgcaa
aaggtcgagaggtctgtgatcttaaaagaaaatctccttcagatctttggaaagaagatt
tagcagcatttgttgaagaattggagaaagtggaagcacaagaacgagaagatgttctgg
ctggaatgtctggaaaagcaataaaaggtaaagttggcaaacctaaagtgaagaaacttc
aactggaagagacaatgccctcaccttatgggagaagaatagttcctgaaattactgcta
tgaaggcagatgccagcaaaaagttgctgaagaagaaaaagagtgatcttgatactacaa
cagtaaaaatagaatttgatgaagaattcagtggaataccagtagaaggtacaggagaag
aggcattggtcccatcagctcctataaataaagttcccaaacccaaaagggagaaaaaag
agcctgggaccagggtgagaaaaacacctacatcatctggtaaatccagcacaaagaaag
tgaaaaaacggaatccttggtcagatgatgaatccaagtcagaaagtgacttggaagaaa
cagaacctgtggttattccaagagattctttgcttagaagagcagctgctgaaaggccta
agtacacatttgatttctcagaagaagaggatgatgatgctgatgatgatgatgacaata
atgatttagaggagttgaaagttaaagcatctcccataacaaacgatggggaagatgaat
atgttccttcagatggcctagataaagatgaatatgcattttcaccaagtaaatcaaaag
cagctccagaaaaatcttcacatgacaaaaaaagtcaggattttgggaatctcttttcat
ttccttcatactctcagaagtcagaagatgattcagctaaatttgacagtaatgaagaag
attctgcctctgttttttcaccatcatttgggctgaaacaaacagataaagttccaagta
aaacagtagctgctaaaaagggaaaaccgtcttcagatacagtccctaagcccaggagag
ctcctaagcagaagaaagtagagactataaactctgattcggattcagaatttggcattc
caaagaagactccaacaccaaaaggtaaaggccgaggggcaaagaaaaggaaagcatctg
gctctgaaaatgaaggtgattataaccctggcaggaaaacgtccaaaacaacaagcaaga
aaccgaagaaaacatcttttgatcaggattcagatgtggacatcttcccatcagacttca
cttctgaaccaccttctctaccacggaccggtcgggctaggaaagaagtaaaatactttg
cagagtctgatgaagaagaagatgttgattttgcaatgtttaattaa

DBGET integrated database retrieval system