KEGG   Manis javanica (Malayan pangolin): 108392297
Entry
108392297         CDS       T06054                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta type
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04064  NF-kappa B signaling pathway
mjv04140  Autophagy - animal
mjv04270  Vascular smooth muscle contraction
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04920  Adipocytokine signaling pathway
mjv04931  Insulin resistance
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108392297 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108392297 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    108392297 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    108392297 (PRKCQ)
   04659 Th17 cell differentiation
    108392297 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108392297 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108392297 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108392297 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108392297 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108392297 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108392297 (PRKCQ)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     108392297 (PRKCQ)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   108392297 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING_9 Kinase-like Zf_RING zf-RING-like C1_2 APH
Other DBs
NCBI-GeneID: 108392297
NCBI-ProteinID: XP_017507912
LinkDB
Position
Unknown
AA seq 706 aa
MSPFLRIGLSNFDCGSCQPCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETESFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCEACGMNVHHKCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEHIFREGPVEIGLPCSMKGEAQLPYIPAPGKREPQGISWECPSEETEKVCHHP
EPELNVEKPSLHMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQACHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDTKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFQEINWEELERREIEPPFRPKVKSPYD
CSNFDKEFLNEKPRLSLADRALINSMDQNMFKNFSFINPGMERLIS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtcaccatttcttcgaattggtttgtccaactttgactgcgggtcctgccagccgtgt
cagggagaggctgttaacccttactgcgctgtgctggtcaaagaatatgtggagtcggaa
aatgggcagatgtatatccagaaaaagccaaccatgtacccgccctgggacagcactttc
gacgcccacatcaacaagggaagggtaatgcagatcattgtgaagggcaagaatgtggac
ctgatttccgaaactacagtggagctctactccctggctgagagatgtaggaagaacaat
gggaagacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagcgacacaaaggacatgagtgaatttgagactgagagcttcttt
gctttgcatcaccgccgaggagccatcaaacaggccaaggtccaccatgtcaagtgccat
gagttcaccgccacctttttcccacagcccacgttttgctctgtctgccatgagtttgtc
tggggtctgaacaagcagggctaccagtgtcgacaatgtaatgcggcaattcacaagaag
tgtattgataaagttatagcgaagtgcacaggatcagctatcaatagccgagaaaccatg
ttccacaaggagaggttcaaaattgacatgccgcacagattcaaagtctacaattacaaa
agcccgaccttctgcgagcactgcgggaccctgctgtgggggctggccaggcaaggcctc
aagtgtgaggcatgtggcatgaacgtccatcacaagtgccagacaaaggtggctaacctt
tgtggcataaaccagaagctaatggctgaagcactggcaatgatcgagagcactcagcag
gctcgctgcttaagagatacggaacacatcttcagggaaggcccagtggaaattggtctc
ccatgctccatgaagggtgaagcacagctgccatatataccagcaccggggaaaagagag
cctcagggaatctcctgggagtgtccctcggaggagacggagaaagtgtgccatcatcca
gaacctgaactgaacgtagaaaaaccatctctacatatgaaattaaaaatcgaggatttt
atcttgcacaaaatgttggggaagggaagttttggcaaggtctttctagcagagttcaag
aaaaccaatcaatttttcgcaataaaggccttaaagaaagatgtcgttttaatggatgac
gatgttgagtgcaccatggtggagaagagggttctctccttggcctgggagcatcctttc
ttgacgcacatgttctgtacattccagaccaaggaaaacctcttttttgtgatggagtat
ctcaatggaggagacttaatgtaccacatccaggcctgccacaagtttgatctctccaga
gcaacgttttatgctgctgaaatcattcttggtctgcagttcctccattccaaaggaatt
gtctacagggatctgaagctagataatatcctgttagacaaagatggacatatcaaaata
gcggactttggaatgtgcaaggagaacatgctcggagacaccaagacaaacactttctgc
gggacccctgactacatcgccccggagatcttgctgggtcagaaatacaaccactctgtt
gactggtggtccttcggcgtcctcctctacgaaatgctaataggtcagtcgccattccat
gggcaagatgaggaagagctcttccactccatacgcatggacaaccccttttatccacga
tggcttgaaaaggaggctaaagaccttttagtgaagctcttcgtgagagaaccggagaag
aggctgggcgtgaggggagacatccgccagcaccctttgtttcaggagatcaactgggaa
gagctggaaaggagggagattgagccgcccttccggcccaaagtgaaatcaccgtatgac
tgcagcaattttgacaaagaattcttaaatgagaaaccccggctgtcactggctgacaga
gcactgatcaacagtatggaccagaatatgttcaaaaacttttccttcattaacccaggg
atggagaggctcatatcctga

DBGET integrated database retrieval system