KEGG   Manis javanica (Malayan pangolin): 108392567
Entry
108392567         CDS       T06054                                 

Gene name
ACVR1C
Definition
(RefSeq) activin receptor type-1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108392567 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392567 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108392567 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108392567 (ACVR1C)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108392567 (ACVR1C)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108392567 (ACVR1C)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Pkinase_fungal Activin_recp
Other DBs
NCBI-GeneID: 108392567
NCBI-ProteinID: XP_017508384
LinkDB
Position
Unknown
AA seq 443 aa
MLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPDAPKLG
PMELSVVITVPVCLLSIAAALTAWARQGRQCTHRTRKRQNVEEPLSECNLVNAGKTLKDL
IYDVTASGSGSGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVA
GMIKLALSVASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDS
ILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGI
VEEYQLPYYDMVPSDPSIEDMRKVVCDQKFRPNIPNQWQSCEALRVMGRIMRECWYASGA
ARLTALRIKKTISQLCVKEDCKA
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgttaaccaatgggaaagaacaggtgatcaagtcctgtgtttctctcccagagctaaat
gctcaagtcttctgtcacagttccaacaatgttaccaaaactgaatgctgcttcacagat
ttttgcaacaacataacactgcaccttccaacagcgtcaccagatgcccccaaactcgga
cccatggagctgagcgttgttatcacggtgcctgtgtgcctcctgtccatagctgcggcg
ctgaccgcgtgggcacgccagggtcgacagtgcacgcacagaacgagaaagaggcaaaac
gtggaggaacccctctctgagtgcaatctggtaaatgctgggaaaacgctaaaagatctg
atttatgatgtgactgcctctggatctggctccggtctacctctcttggttcaaagaaca
attgccaggacgattgtacttcaggagattgtaggaaaaggtagatttggtgaggtctgg
catggaagatggtgtggggaagatgtggctgtgaaaatattctcctccagagatgaaaga
tcttggtttcgtgaggcagaaatttatcagacggtaatgctgagacatgaaaacatactt
ggtttcattgctgctgataataaagataatggaacttggactcaactttggcttgtctct
gaatatcatgagcagggctccttatatgactatttgaacagaaacatagtgactgtggct
ggaatgatcaaactggcactctcagtagccagtgggctggcccaccttcatatggagatt
gtgggcactcaaggtaaacctgctattgctcatcgagatataaaatcgaagaatatctta
gtgaaaaaatgtgaaacttgtgccatagcagacttagggttggctgtgaagcatgattca
atactgaacacaatagatatacctcagaatcctaaagtggggaccaaaaggtatatggct
cctgaaatgcttgacgatacaatgaatgtgaatatctttgagtcctttaaacgagctgac
atctattctgttggtctggtttactgggaaatagcacgaaggtgttcagttggaggaatt
gttgaggagtaccaattgccttattatgacatggtgccttcagatccctcaatagaggac
atgaggaaggtcgtttgcgaccagaagtttcgaccaaatatcccaaaccagtggcaaagc
tgtgaagcactccgagtcatggggagaataatgcgtgagtgttggtatgccagtggggca
gcccgcctaactgcccttcgtattaagaagaccatttctcaactttgcgtcaaagaagac
tgcaaagcctaa

DBGET integrated database retrieval system