KEGG   Manis javanica (Malayan pangolin): 108392856
Entry
108392856         CDS       T06054                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04664  Fc epsilon RI signaling pathway
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05221  Acute myeloid leukemia
mjv05310  Asthma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108392856
   04151 PI3K-Akt signaling pathway
    108392856
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392856
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108392856
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108392856
   04664 Fc epsilon RI signaling pathway
    108392856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108392856
   05202 Transcriptional misregulation in cancer
    108392856
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    108392856
  09163 Immune disease
   05310 Asthma
    108392856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108392856
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108392856
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108392856
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Haparin
  Cytokines
   108392856
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 108392856
NCBI-ProteinID: XP_017508838
LinkDB
Position
Unknown
AA seq 141 aa
MSSLPILHFLLLLLRLQVPQAQGFPTLRPDQYSVIVTEILRALNKSPLASQNPLNWNDKL
ILRNRALLRPNLDAFLDAASNLYGNDSQIRKNLKEFRPILPTPTTEADQIRIEESNKGDF
QRKLKQYLVTINSFLRDRNRH
NT seq 426 nt   +upstreamnt  +downstreamnt
atgagcagcctccccattctgcactttctcttgctcctgctcagactccaagtccctcag
gcacagggcttcccgacactccggcctgaccagtactctgtgatagtcactgagattctg
agagccctcaacaagtcacctttggcttcacaaaaccccttgaactggaatgacaaattg
atcctgcggaacagggcccttctgaggccaaacctggatgcatttctggacgctgccagt
aatttgtatgggaacgactcacaaatcaggaaaaatctgaaggaattccggcctatcctg
cccacccccacgactgaggcagaccaaatccgtatcgaggagagtaacaagggtgatttc
cagcgtaaattgaagcagtatctggtaaccattaatagtttcctgcgtgacaggaacagg
cattga

DBGET integrated database retrieval system